Details for Arabidopsis Locus AT1G79350

Position : Chr1 ( 5`- 29844633 .. 29853414 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79350

Protein [Map View]
MTQSPVQPPPPLPAQPHSAAGGVIRGDVQVRCAGCRVILRVKTGVVEFSCPTCQLPQMLPPELLSRARPQFPQSPQQPPQ
PIQTLPPPIQQQLKPLNLPRPPVPAHGIDPTKMQLPCANCQAILNVPHGLTRFSCPQCHVELAVDVSKLNRSLTASQSHS
NPPTPAAPTVPPPPPPEEVNEEAIEVEREEDEGGTAGETFMDYRPPKLSIGPPHPDPIVETSSLSAVQPPEPTYDLKIKE
ELERSKALSCLQIETLVYACQRHLQHLADGTRAGFFVGDGAGVGKGRTIAGLIWENWKHGRRKALWISIGSDLKYDARRD
LDDVGATCVGVNPLNKLPYSKLDSKNVGIKEGVVFLTYNSLIASSEKGRSRLQQLVQWCGPEFDGLLIFDECHKAKNLVP
EAGSQPTRIGQAVVDIQDKIPQARVIYCSATGASEPRNMGYMVRLGLWGAGTSFSDFNKFLGALDKGGTGALELVAMDMK
ARGMYVCRTLSYKGAEFEIVEARLEAGMEAMYNKSAEFWAELRIELLSASAFLPNEKPNSSQLWRLYWSSHQRFFRHLCM
SAKVPVTVRLAKKALSTNKCVVIGLQSTGEARTEEAVNKYGLELDDFVSGPRELLLKFVEENYPLPEQPEPLSEDDSVKE
LQRKRHSASPGVSIRGRVRKMAKWKPDSDNESDLESEADSADDSNDSDDEFQICQICSGEDERKKLLHCSECDKLFHPDC
VVPPVIDLPSEAWICFSCKEKTEEYIQARRLYIAELQKRYEAALERKSKIIEIIRSLNLPNNPLDDIVDQLGGPEKVAEM
TGRRGMLVRASNGKGVTYQARNTKDITMEMVNMHEKQLFMDGKKLVAIISEAGSAGVSLQADRRAVNQKRRVHLTLELPW
SADRAIQQFGRTHRSNQTSAPEYRLLFTNLGGERRFASIVAKRLETLGALTQGDRRAGPSGPSLSAYNYDSNFGKKSLMV
MYRGIMEQEKLPVLPPGCSIDEPETVKEFLTKARAALVAVGIVRDSVLANGKDVGRFSGRIIDSDMHDVGRFLNRLLGLP
PDIQNRLFELFTSILDVLVHNARIEGSFDSGIVDMKANSVELLSTPKTVHVDQMSGASTMLFTFTLDRGVTWESASSMLE
GKRRDGLGSANDGFFESKREWLGRRHFILAFESAASGLFKIVRPAVGESIREMSLSELKTKYRKLSSLEKARTGWEDEYE
VSSKQCMHGPKCKLGEYCTVGRRIQEVNVVGGLILPIWGTIEKALSKQARHSHKRIRVIRIETTTDNQRIVGLSIPNAAV
ETVLQDLAWVQEIDD*

DNA
ATGACGCAGTCGCCTGTTCAACCGCCTCCGCCGCTCCCAGCTCAGCCGCATTCCGCCGCCGGAGGTGTAATAAGAGGCGA
TGTACAGGTTAGGTGCGCAGGCTGTCGCGTGATTCTGAGGGTGAAAACCGGCGTTGTGGAGTTCTCGTGTCCGACTTGTC
AACTTCCCCAAATGTTGCCGCCGGAGCTTCTTTCTAGGGCACGGCCGCAGTTTCCGCAGTCTCCACAACAACCACCACAG
CCAATTCAGACGCTTCCGCCACCGATTCAACAGCAGCTTAAGCCTCTTAATCTACCTAGGCCTCCGGTTCCGGCACATGG
AATCGATCCGACGAAGATGCAATTGCCTTGCGCTAACTGTCAGGCTATCCTCAATGTGCCTCATGGACTCACTCGGTTCT
CGTGTCCTCAGTGCCATGTCGAGCTCGCTGTTGATGTCTCCAAGCTTAATCGGTCTTTAACTGCTTCTCAATCTCATTCT
AATCCTCCTACTCCTGCTGCTCCCACAGTCCCGCCTCCGCCTCCTCCCGAAGAAGTCAATGAGGAAGCTATTGAAGTGGA
GAGAGAAGAAGATGAAGGTGGAACGGCTGGAGAAACGTTTATGGATTATCGTCCCCCAAAACTTTCGATCGGACCTCCTC
ATCCTGATCCAATTGTGGAAACATCATCTCTATCTGCAGTGCAACCCCCAGAGCCTACTTATGATCTCAAAATCAAGGAA
GAGCTTGAAAGGTCAAAGGCTTTATCGTGTTTGCAGATTGAGACATTAGTTTACGCTTGCCAGAGGCATCTCCAGCACCT
TGCTGATGGTACCAGAGCAGGCTTTTTTGTTGGAGATGGTGCTGGTGTGGGCAAAGGGCGAACAATTGCCGGGTTGATTT
GGGAAAATTGGAAACATGGAAGGAGGAAAGCTTTGTGGATTTCTATTGGCTCAGACTTGAAATATGATGCAAGAAGGGAC
TTGGATGATGTGGGTGCTACATGCGTTGGAGTGAATCCTTTGAACAAGCTACCCTATTCTAAGCTTGACTCGAAAAATGT
TGGTATTAAAGAAGGAGTGGTATTCTTGACATACAATAGCCTCATTGCTTCCTCTGAGAAGGGCCGTTCTCGTTTACAGC
AGCTTGTTCAATGGTGTGGACCAGAATTTGATGGTCTCTTGATCTTTGATGAGTGCCATAAAGCGAAAAATTTGGTACCT
GAAGCTGGGAGTCAGCCGACACGCATCGGACAGGCAGTTGTTGACATTCAGGATAAGATCCCCCAAGCACGTGTTATTTA
TTGCTCGGCTACTGGGGCATCAGAACCACGAAACATGGGTTATATGGTCAGGCTTGGTCTTTGGGGAGCTGGAACAAGTT
TTAGTGATTTTAACAAATTCCTAGGTGCCCTTGATAAAGGTGGGACAGGAGCGTTGGAATTGGTTGCCATGGATATGAAA
GCGAGGGGGATGTATGTATGCCGAACCCTGAGTTACAAAGGGGCTGAGTTTGAGATTGTTGAAGCTCGTTTAGAAGCAGG
AATGGAGGCAATGTACAATAAGTCTGCAGAATTTTGGGCAGAGCTACGGATAGAGTTGTTGTCAGCAAGTGCTTTTCTCC
CTAACGAGAAACCAAATTCTAGTCAGTTGTGGAGATTATACTGGTCAAGCCACCAGCGTTTCTTTAGACACCTGTGTATG
TCAGCTAAAGTCCCTGTAACTGTGAGGTTAGCTAAGAAAGCCTTGTCAACAAACAAGTGTGTAGTTATTGGCCTTCAGAG
TACTGGAGAGGCTCGAACCGAAGAGGCTGTAAATAAATATGGTCTTGAGCTTGATGATTTTGTCTCGGGACCTCGAGAGC
TCTTGTTGAAATTTGTGGAAGAGAATTATCCCTTACCCGAGCAGCCTGAACCTCTGTCAGAGGATGATAGTGTTAAAGAA
CTTCAGAGGAAGAGGCATTCAGCTTCACCTGGTGTTTCAATTAGAGGGAGAGTAAGAAAGATGGCAAAGTGGAAACCAGA
TAGTGATAATGAAAGTGATTTGGAGTCTGAAGCTGACTCTGCTGACGATTCTAATGATTCTGATGATGAGTTCCAGATAT
GTCAGATATGCAGTGGGGAAGATGAAAGGAAGAAGTTGCTCCATTGTTCTGAATGTGACAAGCTTTTTCATCCGGACTGT
GTGGTTCCTCCAGTTATAGACTTACCATCTGAAGCGTGGATTTGCTTTTCTTGTAAGGAAAAGACAGAGGAGTACATTCA
AGCAAGACGTCTTTACATTGCCGAATTGCAGAAAAGGTATGAAGCAGCGCTTGAACGAAAATCAAAGATCATAGAGATCA
TCCGTTCTCTGAATCTTCCAAACAATCCTTTGGATGACATCGTCGATCAGCTTGGAGGCCCTGAAAAAGTTGCAGAAATG
ACGGGCAGGCGAGGTATGCTTGTAAGAGCATCGAATGGGAAAGGTGTTACATATCAAGCAAGAAACACAAAGGATATTAC
CATGGAAATGGTCAACATGCACGAGAAGCAACTATTTATGGATGGTAAAAAGTTGGTTGCCATTATTTCTGAAGCTGGGT
CAGCTGGTGTTTCGTTGCAAGCAGATAGAAGGGCAGTAAATCAGAAAAGAAGGGTTCACTTGACTTTAGAGCTTCCCTGG
AGTGCTGATCGTGCAATTCAGCAATTTGGAAGAACTCACCGGTCAAATCAGACATCTGCACCTGAATATAGACTACTCTT
CACTAATCTCGGTGGGGAACGCCGCTTTGCCTCTATTGTTGCAAAGAGACTAGAAACACTTGGTGCTTTAACACAGGGAG
ACCGCAGGGCTGGGCCCTCCGGGCCTTCTTTGAGTGCGTATAATTATGATAGTAACTTTGGTAAAAAATCCTTGATGGTG
ATGTATCGAGGCATAATGGAGCAGGAGAAACTACCTGTTCTTCCTCCTGGATGCTCGATTGATGAACCCGAAACAGTTAA
AGAGTTTTTGACCAAGGCAAGGGCTGCTCTTGTTGCGGTTGGAATTGTTAGGGACAGTGTTCTGGCCAATGGGAAAGATG
TTGGAAGGTTTTCAGGACGTATTATTGATTCTGACATGCATGATGTTGGACGATTTTTGAATCGCCTCTTAGGATTGCCA
CCTGATATCCAGAATAGGCTGTTTGAATTGTTTACTAGTATATTAGACGTTCTTGTACATAATGCTCGGATAGAAGGAAG
TTTTGACTCAGGAATTGTGGATATGAAAGCTAATAGTGTTGAGCTACTGAGCACTCCAAAGACCGTCCATGTTGATCAAA
TGTCTGGTGCCTCAACTATGCTCTTTACTTTTACTCTAGATCGTGGTGTAACATGGGAGTCTGCGAGTTCAATGCTAGAG
GGAAAGAGAAGGGACGGGCTTGGTTCAGCTAATGATGGCTTTTTTGAATCTAAAAGGGAATGGTTAGGAAGACGGCACTT
CATATTAGCATTTGAGAGTGCCGCTTCTGGGTTGTTTAAGATTGTACGTCCTGCTGTAGGAGAGTCGATCAGGGAGATGT
CTCTTTCAGAGTTGAAAACTAAATACCGAAAACTATCTTCTCTGGAGAAGGCTCGTACTGGTTGGGAGGACGAGTACGAA
GTTTCATCAAAACAGTGTATGCATGGACCCAAGTGTAAGCTTGGGGAGTATTGCACGGTTGGACGTAGGATACAGGAAGT
AAACGTTGTGGGTGGCCTTATTCTTCCCATCTGGGGAACCATCGAGAAAGCTCTCTCCAAACAAGCCCGTCACAGCCACA
AGAGAATTCGAGTTATACGCATAGAGACTACGACGGATAATCAGCGGATAGTGGGCCTCTCCATCCCAAATGCAGCTGTA
GAAACTGTTTTACAAGATTTAGCATGGGTTCAAGAGATTGATGATTAA