Details for Arabidopsis Locus AT1G79310

Position : Chr1 ( 5`- 29833921 .. 29835545 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79310

Protein [Map View]
MAKRALLIGINYPGTTEELQGCVNDVHRMHKCLVDRFGFAEEDITVLIDTDESYTQPTGKNIRQALSELIKPAKSGDVLF
VHYSGHGTRVPPETGEEDDTGFDECIVPSDLNPIPDDDFRDLVEQVPEGCQITIVSDSCHSGGLIDEAKEQIGESTTTKP
NRESKVSSFEFEFKNCLHSIFVKLLAFCGIGSSHVETREIVEVGEGDEVVRSRYLPLERFIELLKQQTGQDNIEIGKIRP
TLFDVFGEDSSPKIKKFMKVILTKLRKTNDQSTLLGKIEESARGYIEETLNDEHYMKPAMQAQVKSDREIYGGRSSNGLF
PDRGILLSGCQTDETSADVKKKGEAFGAFSNAIQMVLSETDHKDKITNKEMVLRAREILKKQMFIQRPGLYCNDRFVNAP
FIC*

DNA
ATGGCAAAGAGAGCGTTGTTGATAGGAATCAACTATCCAGGAACCACGGAGGAGCTACAAGGCTGCGTCAATGACGTCCA
TAGAATGCATAAGTGTCTCGTTGACCGGTTCGGATTCGCGGAGGAAGATATCACTGTGCTGATTGACACCGACGAATCTT
ACACTCAACCCACAGGAAAGAACATCCGTCAGGCTTTGTCGGAGCTCATAAAGCCAGCAAAATCCGGTGACGTTTTATTC
GTGCATTACAGCGGACACGGCACGAGAGTCCCACCGGAAACAGGGGAAGAGGATGATACAGGTTTTGATGAGTGTATTGT
TCCTTCCGACTTGAATCCAATTCCTGATGATGATTTCAGGGATTTAGTGGAACAAGTTCCAGAGGGATGTCAGATAACTA
TCGTATCAGACTCTTGTCACAGCGGCGGGCTCATTGATGAAGCTAAGGAACAGATCGGAGAGAGTACCACGACGAAGCCA
AATCGAGAATCCAAAGTTTCTTCTTTTGAATTCGAGTTTAAAAACTGTTTGCATAGCATTTTTGTGAAACTGCTTGCTTT
TTGTGGAATCGGAAGTTCTCATGTAGAGACGCGCGAGATCGTAGAAGTAGGCGAGGGAGATGAAGTTGTCAGATCAAGGT
ATCTGCCGTTGGAGAGGTTTATTGAACTTCTCAAACAACAAACTGGGCAAGACAATATCGAGATTGGGAAAATCAGACCC
ACCCTTTTTGATGTCTTTGGTGAAGATTCGAGCCCGAAGATAAAGAAGTTCATGAAAGTGATTCTTACCAAGCTAAGGAA
AACAAATGACCAAAGTACGCTACTTGGTAAGATCGAAGAAAGTGCTCGAGGGTATATAGAAGAGACGCTGAACGATGAAC
ACTACATGAAACCCGCAATGCAGGCACAAGTGAAGAGCGATCGTGAGATTTATGGAGGAAGATCAAGCAACGGATTGTTT
CCTGACCGAGGGATTCTGTTGAGTGGATGTCAAACAGATGAGACATCAGCAGATGTTAAGAAGAAAGGAGAAGCGTTTGG
AGCGTTTAGTAATGCCATCCAAATGGTTTTGTCAGAGACTGATCATAAAGATAAGATTACAAACAAGGAAATGGTATTGA
GGGCAAGAGAGATTCTGAAGAAACAGATGTTTATTCAGAGACCAGGATTGTATTGCAATGACCGCTTTGTGAATGCTCCG
TTTATATGCTAA