Details for Arabidopsis Locus AT1G79230

Position : Chr1 ( 5`- 29800693 .. 29803939 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79230

Protein [Map View]
MASTLFSRTFLAASHRLITPSLPQKIFNPATFLSRSLHSQLGSASTAYKSTTWARRAMASTGVETKAGYSTSSVSTSEPV
VSVDWLHANLREPDLKILDASWYMPDEQRNPIQEYQVAHIPRALFFDLDGISDRKTSLPHMLPTEEAFAAGCSALGIDNK
DEVVVYDGKGIFSAARVWWMFRVFGHEKVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKIYQGQTVSPITFQ
TKFQPHLVWTLDQVKNNMEDPTYQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCIPFPQMFDSCNTLLPAEELKKRFDQ
EDISLDKPIMASCGTGVTACILAMGLHRLGKTDVPIYDGSWTEWATQPDLPIESVESSS*

DNA
ATGGCCTCGACCCTTTTCTCCAGAACTTTCTTGGCTGCTAGTCACCGACTGATTACTCCTTCTCTTCCGCAAAAGATCTT
TAATCCAGCCACCTTTCTCAGTAGGTCACTCCACTCTCAGTTAGGCTCCGCTTCTACAGCCTATAAATCAACTACTTGGG
CTCGTCGAGCTATGGCTTCTACTGGAGTTGAGACAAAAGCCGGTTACTCCACATCATCCGTATCAACCAGTGAACCTGTT
GTTTCTGTTGATTGGCTTCATGCTAATCTTAGAGAGCCTGATTTGAAGATTTTGGATGCTTCATGGTATATGCCGGATGA
GCAGAGAAATCCGATCCAAGAATATCAGGTTGCTCATATTCCCCGCGCTCTCTTCTTTGATTTGGATGGAATATCAGATC
GAAAAACTAGTTTGCCACATATGTTGCCCACTGAGGAAGCTTTTGCTGCTGGTTGTTCTGCTCTTGGAATTGATAACAAA
GATGAAGTGGTTGTCTATGATGGAAAGGGGATCTTTAGTGCAGCCCGTGTATGGTGGATGTTCCGAGTTTTTGGACATGA
AAAAGTTTGGGTGCTCGATGGAGGTCTACCAAGATGGCGTGCATCAGGTTATGATGTTGAATCTAGTGCATCAGGTGATG
CTATTCTGAAAGCCAGTGCCGCAAGTGAGGCTATAGAGAAAATTTATCAAGGACAAACCGTCAGTCCGATAACCTTTCAG
ACTAAGTTCCAGCCACATCTAGTGTGGACACTTGATCAGGTCAAGAACAATATGGAGGATCCGACTTATCAACACATAGA
CGCTCGTTCCAAAGCCAGGTTTGATGGTACTGCTCCAGAACCCCGTAAGGGAATAAGAAGCGGTCATATACCTGGAAGCA
AATGTATCCCTTTTCCTCAGATGTTTGATTCTTGTAACACATTGTTACCAGCAGAGGAGCTGAAGAAACGATTTGACCAA
GAAGATATCTCACTGGACAAGCCTATTATGGCCTCGTGTGGGACTGGTGTAACAGCTTGCATCTTGGCAATGGGGCTTCA
CCGGCTGGGGAAAACCGACGTGCCGATCTATGATGGGTCGTGGACTGAATGGGCGACACAACCAGACTTGCCCATAGAGA
GTGTTGAATCTTCTTCATGA