Details for Arabidopsis Locus AT1G79200

Position : Chr1 ( 5`- 29794387 .. 29796040 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79200

Protein [Map View]
MVSERSSKEKKRSRARSEDSSSSDYEEKVKRHRGTEKDDERRSRRSDKKDKKSHKHHKSSTSKKSKDDKPKKKHTESDHK
LKEGIPELSMEDYFSKNNEFATWLKEEKRTYFNDLTTEAARGLFSRFVKRWNRGKLESRYYEGISTAPRTAHDWMIKRR*

DNA
ATGGTAAGCGAACGGAGCTCCAAGGAGAAGAAGAGAAGCAGAGCTCGGAGCGAAGATTCTTCATCTTCCGATTACGAAGA
GAAAGTTAAGAGGCATCGAGGAACAGAGAAAGATGATGAAAGGAGAAGTAGGAGAAGTGATAAGAAGGATAAGAAATCTC
ACAAGCACCACAAATCCAGTACATCAAAGAAGTCCAAGGATGATAAGCCGAAAAAGAAACATACGGAAAGCGACCACAAG
CTAAAAGAGGGAATTCCAGAGCTATCAATGGAAGACTACTTCTCGAAAAACAACGAGTTTGCTACATGGCTGAAAGAAGA
AAAACGTACTTACTTTAATGATCTCACGACCGAAGCTGCACGAGGACTGTTCTCACGATTTGTCAAGAGATGGAACAGAG
GAAAACTCGAGTCTCGATACTACGAGGGAATCTCCACTGCCCCACGAACAGCTCACGACTGGATGATCAAGCGTAGGTGA