Details for Arabidopsis Locus AT1G79160

Position : Chr1 ( 5`- 29779721 .. 29780773 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79160

Protein [Map View]
MILDMAADVSSLVRLLSGYKDDRAVVKDSAGAKSSAALMTRDLLGNGRGGGGDRSLELDLDLQVPTGYEKRLDLKSGKVY
LQRCNSTSSSSITNADQTNQTVPTFQDLNFPPPTLNNSPLLNLFDDTTPELKLLPSSRSSRPNTSNLQSVCTLDKVKSAL
ERAERDPAMFKKRQSPDDTVYDHYRTEAVASPVVAGCPGCLSYVLVMMNNPKCPRCDTIVPLPTNPMKKKPKIDLNISI*

DNA
ATGATTCTTGATATGGCTGCTGACGTCAGCTCTCTCGTACGGTTACTAAGCGGTTACAAAGATGATCGAGCGGTGGTTAA
AGATTCTGCCGGAGCCAAATCCTCGGCGGCGCTGATGACTCGTGACCTTCTTGGAAACGGCAGAGGAGGAGGAGGCGATC
GGTCTTTAGAGCTTGACCTCGACCTTCAAGTCCCCACCGGTTATGAAAAACGCCTCGACTTGAAGTCAGGGAAAGTGTAT
TTGCAACGATGCAATTCAACGAGCTCGTCGTCAATAACAAACGCAGACCAAACCAATCAAACAGTACCAACGTTTCAGGA
TTTGAATTTTCCTCCTCCGACTTTGAACAATTCTCCTTTGTTGAACCTCTTCGACGATACAACGCCGGAACTGAAGCTAC
TTCCGTCGTCTCGTTCTTCTCGTCCGAACACTAGTAATTTACAGAGTGTATGCACACTGGACAAGGTGAAATCAGCTCTA
GAGAGGGCAGAGAGAGATCCTGCTATGTTCAAGAAACGTCAATCACCGGATGATACGGTTTACGATCATTATAGGACGGA
GGCTGTAGCGTCACCGGTGGTTGCCGGATGTCCTGGTTGTTTATCGTACGTGTTGGTGATGATGAATAACCCGAAATGTC
CGAGGTGTGATACCATTGTTCCTTTGCCTACAAATCCTATGAAGAAGAAGCCTAAGATTGATCTCAACATATCAATCTGA