Details for Arabidopsis Locus AT1G79150

Position : Chr1 ( 5`- 29772588 .. 29777989 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79150

Protein [Map View]
MGKNRRKQKVIPPPLLPPDVAEEDIEFSDEDLKYVKENTDYAQFVSQIDTAAINKQCGGRVMTVEDKYEEERSKRKTLQE
EKGNGEILVDPVDVLPVKTLDGKLHYRTESKKSKLAEAETDEAEKDVLEDEHVLNKSQRREKAKKSKREAKKHEKDLPDE
ILQEEEETPQAAVLAEVKEELSAEESFENKKNKIAELGMLLLSDPEANIKTLKDMLDICKDQNTKIVKLALLSLLAVFKD
IIPGYRIRLPTEKELEMKISKEVKKTRFYESTLLKAYKSYLQKLIIFEKQSVYNQIANRCLCTLLEAVPHFNYRDNLLIA
VVRNISSPDEVVRRLCCSTIRYLFSNEGKHGGELTVQAVRLIADHVKAHNCQLHPNAIEVFMSIRFDEDIGKPNKEDEHN
KKYKKNNKRKTQEEQNQVQENERKKSKKDMMSKIRDEVSADHRGVTYEPDAKERRKMQTETLSAVFETYFRILRNTMYTI
GERTEEIPTSNPGAFGSHPLLAPCLDGLAKFTQQLDLDYMGDLMNYLKKLASSSSSVSNNTKQKNSKLLTVSERLRCCLV
AFKVMRSNLNALNVDLQDFFVQLYNLILEYRPGRDSGVILAESLKIMLCDDRHQDMQKAAAFVKRLATFALCFGCAESMS
ALVTLKTLLQKNVKCRNLLENDAGGGSVSGSIAKYQPYATDPNLSGALATVLWELSLLSKHYHPAISTMATTVSNMNTSQ
SQTFLSAVTPQQAFADFSLVKESFEPKNESRKLNNKRKRESLPEEAKNVPEIDMVKLSKKLKENFTILRDIKEDERVRME
LLQSEEKKPLKKQNNVVKKKLKNPKSKKQI*

DNA
ATGGGCAAAAATAGGCGTAAACAGAAGGTTATACCTCCACCGCTGCTTCCGCCAGATGTAGCCGAAGAGGATATTGAGTT
TTCCGACGAGGATTTGAAGTATGTCAAAGAGAACACAGATTACGCCCAATTCGTCTCTCAAATTGACACCGCCGCTATCA
ATAAGCAATGTGGTGGTAGAGTAATGACAGTGGAGGATAAGTATGAAGAAGAACGATCAAAGAGGAAGACACTTCAGGAA
GAGAAAGGGAATGGCGAGATCCTTGTGGATCCTGTTGATGTGCTCCCTGTCAAGACTTTAGATGGAAAACTTCACTATCG
AACAGAGTCAAAGAAGTCAAAACTAGCTGAAGCCGAAACAGATGAAGCAGAGAAGGATGTTCTTGAAGATGAACATGTAT
TGAACAAATCTCAAAGAAGAGAAAAAGCTAAAAAGAGTAAAAGGGAGGCAAAGAAACATGAGAAAGATTTGCCTGATGAG
ATATTACAAGAGGAAGAAGAAACTCCCCAAGCCGCTGTTCTGGCAGAAGTGAAAGAAGAACTATCTGCTGAAGAGTCATT
TGAAAATAAGAAAAATAAAATCGCGGAATTGGGAATGCTACTACTTTCTGATCCAGAGGCAAACATAAAAACTTTGAAGG
ATATGTTAGATATCTGCAAGGATCAGAATACGAAGATTGTGAAACTTGCCTTGTTATCTCTGTTGGCCGTATTTAAAGAT
ATTATTCCTGGCTATCGGATTAGACTTCCTACAGAAAAGGAGCTCGAGATGAAGATCTCAAAGGAAGTGAAGAAAACCCG
GTTCTATGAGTCGACTTTATTAAAAGCTTACAAGTCATATCTGCAGAAGTTGATTATATTTGAAAAGCAGTCAGTATATA
ACCAAATTGCCAATCGGTGCCTTTGTACATTGCTGGAAGCAGTTCCTCACTTCAACTACCGTGATAACCTGTTAATTGCT
GTTGTCAGAAATATCAGCTCCCCAGATGAAGTCGTAAGGAGACTCTGTTGCTCTACTATCAGGTATCTTTTCTCAAATGA
AGGGAAACATGGTGGTGAGCTGACCGTGCAAGCTGTACGCCTGATTGCTGATCATGTCAAAGCTCACAACTGCCAACTTC
ATCCTAATGCTATCGAGGTGTTCATGTCCATTCGCTTTGATGAGGATATTGGAAAGCCTAACAAAGAGGATGAACATAAC
AAGAAATATAAGAAAAATAATAAAAGAAAAACCCAGGAGGAGCAAAATCAAGTGCAGGAAAATGAGAGGAAGAAATCAAA
GAAAGATATGATGTCTAAGATCAGAGACGAGGTTTCTGCTGATCACAGAGGAGTTACCTATGAACCGGATGCTAAGGAGC
GGCGAAAGATGCAGACAGAGACACTTTCTGCTGTTTTTGAGACCTATTTCCGTATCCTGAGAAACACAATGTATACAATT
GGCGAAAGAACAGAAGAAATTCCAACTTCAAATCCGGGTGCCTTTGGATCGCACCCTTTGCTAGCTCCATGCTTGGATGG
GTTGGCAAAATTCACCCAACAACTGGACTTGGACTACATGGGAGATCTAATGAACTATCTCAAGAAGCTTGCTTCTAGCA
GTAGCAGCGTCTCCAACAACACAAAGCAGAAAAACTCAAAACTGTTGACAGTATCTGAACGCCTTAGGTGTTGCCTTGTC
GCCTTCAAAGTCATGAGGAGCAACTTAAATGCCTTGAATGTTGACTTGCAAGACTTCTTTGTCCAACTTTACAACCTCAT
TCTCGAGTACCGCCCTGGAAGAGATTCAGGTGTAATCTTGGCTGAGTCTCTGAAGATAATGTTGTGCGACGACAGACATC
AAGACATGCAAAAAGCAGCTGCATTTGTAAAACGTTTAGCCACATTCGCGCTATGCTTTGGATGTGCCGAATCTATGTCT
GCGCTAGTCACTTTGAAAACTCTGCTTCAGAAGAACGTGAAATGCAGAAACCTTCTAGAGAACGATGCTGGAGGCGGCTC
TGTTTCCGGTTCAATTGCAAAATATCAGCCGTATGCAACAGATCCTAACCTAAGCGGGGCTTTAGCAACAGTGCTTTGGG
AACTCAGTCTCTTGAGTAAACATTATCATCCTGCGATCTCAACAATGGCCACAACAGTCTCCAACATGAACACTTCTCAG
AGCCAAACATTTCTTTCTGCAGTGACTCCACAACAGGCTTTTGCAGATTTCTCTCTTGTAAAGGAATCGTTTGAGCCGAA
GAACGAGTCTCGGAAATTGAACAACAAACGGAAACGGGAGAGTTTGCCTGAAGAAGCTAAGAATGTTCCGGAAATAGACA
TGGTTAAGCTCAGCAAGAAATTGAAAGAGAACTTTACTATTCTTCGGGATATAAAAGAGGACGAGAGAGTGAGAATGGAG
TTGTTGCAGTCTGAAGAGAAAAAACCATTGAAGAAACAGAACAACGTGGTGAAGAAGAAACTTAAGAACCCTAAATCCAA
AAAGCAAATTTGA