Details for Arabidopsis Locus AT1G79130

Position : Chr1 ( 5`- 29771278 .. 29771887 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79130

Protein [Map View]
MKPLIRRLSRIADSSSCNRNRSGDIHHPTSTYSSSVFLVKRATVASSVPSGHVPVNVGEDKERFVVSAELLNHPVFVGLL
NRSAQEYGYTQKGVLHIPCNVFVFEQVVESLRSGIADDTSELIASLSGEDVSTE*

DNA
ATGAAGCCTCTGATTCGACGTCTGTCACGAATCGCAGACTCATCCTCCTGCAACCGAAATCGCAGCGGCGATATCCATCA
CCCGACGTCAACGTACTCCTCTTCAGTTTTCTTGGTCAAGCGAGCAACCGTCGCGTCGAGTGTTCCTTCCGGTCACGTTC
CCGTCAACGTAGGCGAAGATAAGGAGAGGTTCGTGGTGAGTGCAGAGCTGCTGAATCATCCTGTTTTCGTTGGATTGCTG
AATCGATCAGCTCAAGAATACGGATACACTCAGAAAGGAGTTCTTCATATTCCTTGTAACGTATTCGTGTTCGAGCAGGT
TGTAGAGTCTCTCCGATCTGGCATCGCTGATGATACATCGGAGCTCATTGCATCGTTATCTGGTGAAGATGTATCTACAG
AGTAG