Details for Arabidopsis Locus AT1G79120

Position : Chr1 ( 5`- 29764089 .. 29768789 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79120

Protein [Map View]
MSKPLLYRRSSIFSVILRIHKLRETESFVLFPGESSSRLQWTFVQVRHKSGGGGWRPKQKVYHRVHDLDKAIDLNKKPSL
ILQLKSIIQAQKHGSLLLRDLEKHVGFVHKWNLMAAIEKYPTIFYVGGGHKEPPFVMLTEKAKKIAAEESEATESMEPIL
VNNLRKLLMMSVDCRVPLEKVEFIQSAMGLPQDFKSTLIPKYTEFFSLKVINGKVNLVLENWDSSLAITAREDRLSREGF
SESVGDRKRVRITKDGNFLGRNAFKISFPPGFRPNASYLEEFEKWQKMEFPSPYLNARRFDAADPKARKRVVAVLHELLS
LTMEKRVTCAQLDAFHSEYLLPSRLILCLIKHQGIFYITNKGARGTVFLKDAYAGSNLIEKCPLLLFHDRFVALCGRKEV
NLSNEMQSSSVFS*

DNA
ATGTCTAAACCGTTATTATACAGAAGGTCTTCGATCTTTTCCGTTATTTTGAGAATTCATAAGCTTAGAGAAACTGAAAG
TTTCGTGTTGTTTCCTGGAGAATCATCTAGTAGATTGCAATGGACGTTTGTTCAGGTGAGACACAAGTCTGGTGGAGGAG
GATGGAGACCTAAGCAGAAAGTATATCATAGAGTTCATGACCTTGATAAAGCAATTGACTTGAACAAGAAACCATCTCTG
ATACTTCAGTTGAAATCTATTATCCAGGCGCAGAAACATGGAAGCCTTCTTCTTAGAGATCTTGAGAAGCATGTTGGGTT
TGTTCACAAGTGGAACTTAATGGCTGCCATTGAGAAGTACCCTACGATATTTTATGTTGGAGGTGGACACAAAGAACCTC
CTTTCGTTATGCTGACTGAGAAAGCTAAAAAGATTGCAGCTGAGGAAAGTGAAGCTACAGAGTCAATGGAACCTATTCTG
GTTAATAATCTTAGGAAGTTATTGATGATGTCTGTTGATTGTCGAGTTCCTTTGGAGAAGGTTGAGTTTATTCAATCTGC
AATGGGTTTGCCTCAAGATTTTAAGAGTACATTGATCCCTAAGTACACTGAATTTTTCTCTTTGAAGGTTATCAATGGAA
AAGTTAATCTTGTTTTAGAGAATTGGGATTCTTCACTGGCAATCACTGCACGAGAGGATAGGTTATCCCGTGAAGGATTC
TCCGAGTCAGTTGGGGACAGAAAGAGGGTCAGGATCACAAAGGATGGCAATTTCTTGGGACGAAATGCGTTTAAGATTTC
TTTTCCTCCTGGTTTTAGGCCTAACGCTAGTTATTTAGAGGAATTTGAGAAGTGGCAGAAAATGGAATTCCCATCTCCTT
ATCTTAATGCGAGAAGATTTGATGCTGCAGATCCTAAAGCTAGGAAACGAGTTGTAGCTGTGCTTCATGAACTGCTCAGT
TTAACAATGGAGAAAAGAGTGACATGCGCTCAATTGGATGCATTCCACTCTGAGTATCTGCTTCCATCAAGACTAATACT
TTGCTTGATAAAGCATCAAGGGATCTTCTACATTACTAACAAAGGAGCAAGGGGTACGGTATTTCTCAAAGATGCTTATG
CTGGTTCTAATTTGATTGAGAAATGCCCATTGCTATTGTTCCATGATAGATTTGTTGCACTCTGTGGTCGGAAAGAAGTC
AATTTATCTAATGAAATGCAGTCTTCAAGTGTTTTCTCCTAA