Details for Arabidopsis Locus AT1G79080

Position : Chr1 ( 5`- 29746972 .. 29748944 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79080

Protein [Map View]
MSTLLNSVLSMASPESSPRKAVGFVSHIPSGFLHFSSVSKGVARVLASTQITLSPKDSAFTITGSSWKPDLDSGSFSDDP
RSDEPNLSDSFSHLESLVTGGHKPNVAHSTQLLYDLCKANRLKKAIRVIELMVSSGIIPDASAYTYLVNQLCKRGNVGYA
MQLVEKMEDHGYPSNTVTYNALVRGLCMLGSLNQSLQFVERLMQKGLAPNAFTYSFLLEAAYKERGTDEAVKLLDEIIVK
GGEPNLVSYNVLLTGFCKEGRTDDAMALFRELPAKGFKANVVSYNILLRCLCCDGRWEEANSLLAEMDGGDRAPSVVTYN
ILINSLAFHGRTEQALQVLKEMSKGNHQFRVTATSYNPVIARLCKEGKVDLVVKCLDEMIYRRCKPNEGTYNAIGSLCEH
NSKVQEAFYIIQSLSNKQKCCTHDFYKSVITSLCRKGNTFAAFQLLYEMTRCGFDPDAHTYSALIRGLCLEGMFTGAMEV
LSIMEESENCKPTVDNFNAMILGLCKIRRTDLAMEVFEMMVEKKRMPNETTYAILVEGIAHEDELELAKEVLDELRLRKV
IGQNAVDRIVMQFNLD*

DNA
ATGTCGACTCTACTGAACTCAGTCTTATCCATGGCGTCACCGGAATCATCGCCGAGAAAAGCCGTAGGTTTTGTTTCCCA
CATCCCTTCTGGTTTCCTTCATTTCTCCTCCGTCAGTAAAGGTGTTGCTAGGGTTTTAGCTTCGACCCAGATAACATTAT
CCCCTAAAGACTCCGCCTTTACCATTACTGGATCCAGTTGGAAACCCGATTTGGATTCCGGGTCGTTTTCTGATGACCCG
AGAAGCGACGAGCCGAATTTGAGCGATAGTTTCTCTCATCTAGAAAGTTTAGTCACGGGAGGGCATAAACCCAATGTAGC
TCATTCTACTCAGCTCTTGTACGATCTCTGCAAAGCCAATAGATTGAAGAAAGCCATTCGTGTGATTGAGCTTATGGTTA
GCTCCGGGATTATACCCGATGCATCTGCTTACACGTATTTGGTTAATCAGCTTTGTAAAAGAGGTAACGTTGGTTATGCG
ATGCAGCTTGTTGAGAAAATGGAAGATCATGGTTATCCTTCTAATACCGTTACTTACAATGCCTTGGTTCGAGGTCTTTG
TATGCTTGGTAGCTTAAATCAAAGCTTACAGTTTGTTGAGAGGTTGATGCAGAAAGGCTTAGCTCCAAATGCTTTCACTT
ATTCTTTCTTGCTTGAAGCAGCTTATAAAGAACGAGGAACCGACGAAGCTGTGAAGCTCTTAGATGAGATCATTGTGAAA
GGCGGTGAACCCAATTTGGTTAGCTATAATGTGCTGTTGACTGGTTTCTGTAAAGAAGGGAGAACAGACGATGCCATGGC
GCTGTTTAGGGAATTACCTGCAAAAGGGTTTAAGGCAAATGTTGTGAGCTATAACATTTTGTTGAGGTGTTTGTGCTGTG
ATGGGAGGTGGGAGGAAGCGAATTCGCTCTTGGCTGAGATGGACGGTGGAGATCGAGCTCCTTCAGTTGTTACCTATAAC
ATATTGATCAATTCGTTAGCTTTTCATGGAAGAACAGAGCAGGCACTGCAGGTTTTAAAGGAGATGAGCAAAGGAAATCA
TCAGTTTAGAGTCACTGCCACGAGCTATAATCCGGTGATCGCCCGTCTGTGCAAGGAAGGAAAAGTTGATCTTGTTGTGA
AATGTCTAGACGAGATGATATACCGGCGTTGTAAACCAAACGAAGGAACGTACAATGCAATAGGTTCGTTATGCGAGCAT
AACAGCAAGGTGCAGGAAGCGTTTTACATAATACAGAGCTTAAGCAACAAGCAGAAATGCTGCACGCATGATTTCTACAA
AAGCGTAATCACGAGTCTCTGCAGGAAAGGTAACACCTTTGCAGCGTTCCAGCTCTTGTACGAGATGACTAGGTGCGGGT
TTGATCCCGATGCGCACACCTACTCGGCTTTGATCAGAGGGCTGTGTCTGGAAGGGATGTTTACAGGAGCCATGGAGGTT
TTGTCGATAATGGAAGAGAGTGAGAATTGTAAACCTACAGTGGATAACTTTAACGCCATGATCCTAGGGTTGTGCAAGAT
AAGGAGGACAGATTTGGCAATGGAGGTGTTTGAGATGATGGTTGAGAAGAAGAGAATGCCGAATGAGACAACATATGCGA
TACTCGTTGAAGGGATAGCTCATGAGGATGAATTGGAGCTGGCTAAAGAAGTTCTTGATGAGCTACGATTGCGTAAGGTT
ATAGGACAGAACGCAGTAGATAGGATTGTAATGCAGTTCAATTTAGATTGA