Details for Arabidopsis Locus AT1G79070

Position : Chr1 ( 5`- 29744670 .. 29745815 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79070

Protein [Map View]
MEQLSDSDHRDSADATTSSCQSTTAEDGQCGGGGEAMARGLSAMLESVIKDFDSKALDTLNSQDELSGSLDRLVQELDQL
LENAPLPFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDHMLSANTTQEKASSETT*

DNA
ATGGAGCAGCTATCAGACTCGGACCACCGCGATTCTGCTGATGCAACTACTAGCTCATGTCAATCCACCACCGCAGAAGA
TGGTCAATGCGGCGGCGGCGGAGAAGCAATGGCTCGAGGCTTATCAGCGATGCTCGAGTCCGTCATTAAAGACTTTGACT
CTAAAGCTCTTGACACGCTCAATAGCCAAGATGAACTCTCCGGTTCTCTCGATCGCCTTGTCCAAGAGCTAGATCAATTA
CTGGAAAACGCTCCATTGCCATTCATTGTACAACACGCATCGAGAATTTCCAGCGTCAAACAAAGAGTTTCATCTCTGAA
TCTTGTTCTTAAATCTGTCCAACGACGTATCGATAACATCGATCACATGCTCTCTGCCAACACCACGCAAGAGAAAGCAT
CCTCGGAAACTACATGA