Details for Arabidopsis Locus AT1G79030

Position : Chr1 ( 5`- 29730767 .. 29733611 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G79030

Protein [Map View]
MEDIGLVKQGWKWMQSQKHMCSDACSAMRCFGEMIGGLVERHWPLVCSGCGKLLGLLQLSVLYWKDCIFRGFHCSAKLGS
AALLLIMWSCFLSLTSLSCLLYVLLSMGAAAAVVLNLGCTPGLFIVGLFGILILWMYANFWITGTLFIVGGYLFSLNHAR
VVVLVAGLYAMYCVKVRLGWLGLFLSINLAFLSNDILNCLLQWCDNLSEKPQHEEPKKPKETIIEEDYSREFEYPSVPVE
DETETKIHENKSSAKPTAPSTVVNTVKEISSVKIVKIEESSSADEMKRILNSLNHYEALGVPRHKKIDAAVLKKEYRKKA
MLVHPDKNMGSPLASESFKKLQSAYEVLSDFVKKRDYDEQLRKEESRTRSVCQTSHASSHQSGPDYRSDESRRIHCTKCG
NSHIWICTNRTKAKARWCQDCGQYHQAKDGDGWVELKGTLPFERAHKIEIPRAFVCAESKIFDVSEWAICQGMACRPNTH
RPSFHVNMVGLEKTTQRSNSSRFPWDLDVEMMDEDEEEFELWLQQALASGLFCETSKRRKSWSPFKLGQMKSKKQWRRTS
T*

DNA
ATGGAGGATATTGGGTTGGTTAAGCAAGGTTGGAAATGGATGCAATCTCAGAAACATATGTGCTCCGATGCTTGTTCTGC
GATGCGATGCTTTGGGGAGATGATAGGAGGGCTTGTGGAGCGTCACTGGCCATTGGTGTGTAGTGGATGTGGGAAGCTAT
TAGGATTGCTTCAGTTGTCAGTTCTTTATTGGAAAGACTGCATTTTTAGGGGTTTCCATTGCAGCGCCAAATTGGGTTCA
GCTGCTTTGCTTCTGATAATGTGGAGTTGCTTCCTTAGCTTGACTTCCTTATCTTGCTTGCTCTATGTTCTCCTTAGTAT
GGGAGCTGCTGCAGCTGTTGTTCTGAACTTGGGTTGCACTCCTGGGCTCTTTATCGTAGGACTATTTGGAATTTTGATTT
TATGGATGTATGCAAACTTTTGGATCACTGGAACATTGTTTATAGTCGGAGGCTATTTATTCTCCTTAAATCATGCTCGC
GTGGTGGTTCTTGTGGCGGGCTTATATGCGATGTATTGTGTCAAAGTCAGACTTGGATGGCTTGGTCTTTTCCTCTCAAT
AAATCTTGCTTTCTTGTCCAACGATATATTAAATTGTCTTCTTCAATGGTGTGACAATCTAAGTGAAAAACCACAACACG
AGGAACCAAAGAAACCGAAAGAAACAATCATAGAAGAAGACTATTCAAGGGAATTTGAGTATCCTTCAGTTCCTGTCGAA
GATGAAACCGAGACAAAGATTCACGAGAATAAGTCTTCTGCTAAACCAACTGCGCCTTCTACTGTTGTTAATACCGTAAA
GGAAATTTCTAGTGTTAAAATAGTCAAAATAGAAGAGTCAAGTTCAGCTGATGAAATGAAGAGAATACTGAATAGTTTGA
ATCATTATGAAGCATTGGGGGTCCCTCGGCATAAAAAGATCGATGCTGCGGTGCTTAAGAAAGAGTATAGGAAGAAGGCA
ATGTTGGTTCATCCTGATAAAAATATGGGGAGTCCATTGGCAAGTGAATCATTCAAGAAACTTCAAAGTGCTTACGAGGT
TCTATCTGATTTCGTAAAGAAGAGAGATTACGATGAGCAACTACGAAAAGAAGAATCTAGGACTAGGAGTGTTTGTCAGA
CATCTCATGCTTCTTCGCATCAGAGTGGTCCTGATTATCGATCAGATGAGTCAAGGCGGATACACTGTACAAAATGTGGT
AATTCACACATATGGATATGTACCAATAGGACAAAAGCAAAGGCAAGATGGTGCCAGGATTGTGGCCAATATCATCAAGC
AAAAGATGGAGATGGATGGGTCGAACTCAAAGGGACATTACCCTTCGAGAGAGCACATAAGATTGAAATACCGCGTGCTT
TTGTTTGCGCGGAGAGCAAAATATTTGACGTCTCAGAATGGGCCATTTGTCAGGGAATGGCTTGTAGACCAAACACGCAT
AGACCAAGCTTTCATGTGAACATGGTTGGGTTAGAAAAGACAACACAGAGATCAAACTCAAGTAGGTTCCCATGGGATCT
AGATGTGGAGATGATGGATGAGGACGAAGAAGAGTTTGAGCTATGGCTTCAACAAGCTCTTGCTTCAGGTCTCTTCTGCG
AAACCTCAAAACGTAGAAAAAGCTGGAGCCCTTTCAAGTTGGGCCAGATGAAAAGCAAGAAACAGTGGCGAAGAACTTCC
ACTTGA