Details for Arabidopsis Locus AT1G78990

Position : Chr1 ( 5`- 29713531 .. 29714969 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78990

Protein [Map View]
MGEAAEQARGFHVTTTRKQVITAALPLQDHWLPLSNLDLLLPPLNVHVCFCYKKPLHFTNTVAYETLKTALAETLVSYYA
FAGELVTNPTGEPEILCNNRGVDFVEAGADVELRELNLYDPDESIAKLVPIKKHGVIAIQVTQLKCGSIVVGCTFDHRVA
DAYSMNMFLLSWAEISRSDVPISCVPSFRRSLLNPRRPLVMDPSIDQIYMPVTSLPPPQETTNPENLLASRIYYIKANAL
QELQTLASSSKNGKRTKLESFSAFLWKLVAEHAAKDPVPIKTSKLGIVVDGRRRLMEKENNTYFGNVLSVPFGGQRIDDL
ISKPLSWVTEEVHRFLKKSVTKEHFLNLIDWVETCRPTPAVSRIYSVGSDDGPAFVVSSGRSFPVNQVDFGWGSPVFGSY
HFPWGGSAGYVMPMPSSVDDRDWMVYLHLTKGQLRFIEEEASHVLKPIDNDYLKI*

DNA
ATGGGAGAAGCGGCGGAGCAAGCACGTGGCTTCCACGTGACCACCACCAGGAAGCAAGTCATCACGGCGGCTCTTCCCCT
CCAGGACCACTGGCTCCCACTCTCGAACCTCGACCTCCTCCTTCCTCCTCTCAACGTTCACGTTTGCTTTTGCTACAAGA
AACCACTTCACTTTACCAACACAGTGGCTTATGAAACCCTCAAGACTGCTTTGGCAGAGACTCTCGTCTCCTACTACGCC
TTTGCCGGCGAGCTCGTCACCAATCCTACCGGAGAACCGGAGATCCTCTGCAACAACCGTGGCGTAGATTTCGTGGAAGC
CGGTGCTGACGTGGAGCTCCGAGAGCTTAACCTGTATGATCCTGATGAAAGTATTGCCAAGCTAGTCCCCATCAAGAAAC
ATGGAGTCATAGCGATACAGGTGACTCAACTGAAATGTGGGAGCATAGTTGTAGGCTGCACATTTGATCATCGTGTAGCG
GACGCGTATTCCATGAACATGTTCCTCTTATCGTGGGCCGAGATCTCACGATCAGATGTACCAATCTCTTGTGTACCATC
TTTTCGAAGATCTTTGCTAAACCCACGACGACCATTGGTCATGGATCCATCTATAGACCAGATTTATATGCCTGTCACGT
CCTTGCCCCCTCCACAGGAAACCACCAATCCAGAAAATCTCCTTGCTAGCCGTATCTATTACATCAAAGCAAACGCATTA
CAAGAGCTCCAAACTCTAGCCAGCAGTTCGAAGAACGGTAAAAGGACAAAACTTGAATCATTCAGCGCGTTTCTATGGAA
ACTCGTGGCAGAACACGCTGCAAAAGATCCAGTCCCGATCAAGACCTCGAAACTCGGGATCGTTGTGGATGGAAGGAGGA
GACTTATGGAGAAAGAAAACAATACTTACTTCGGAAACGTTCTCTCAGTCCCATTTGGTGGGCAGAGAATCGATGACTTG
ATCAGCAAGCCACTATCTTGGGTGACCGAAGAGGTTCACAGATTCTTGAAGAAATCAGTGACCAAAGAACATTTCTTGAA
TTTGATCGATTGGGTTGAGACTTGCCGACCAACACCTGCGGTTTCAAGAATCTACAGCGTCGGATCCGACGATGGACCTG
CGTTTGTGGTTTCTTCCGGAAGGAGTTTTCCAGTGAACCAAGTGGATTTCGGGTGGGGCTCACCGGTTTTCGGATCTTAC
CATTTCCCATGGGGAGGCAGCGCCGGATACGTTATGCCGATGCCCAGTTCAGTGGACGACAGAGATTGGATGGTTTACTT
GCACCTTACGAAAGGACAGTTGAGGTTCATTGAGGAAGAGGCTTCTCATGTGCTTAAACCTATTGACAATGATTATCTCA
AGATTTGA