Details for Arabidopsis Locus AT1G78920

Position : Chr1 ( 5`- 29671493 .. 29677537 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78920

Protein [Map View]
MMMDEDVEQASLMSFNDRPRAFPNMRSKTYSPLIFRIIRKLNVRVLSIILLFCFGAIFYMGASTSPIIVFVFTVCIISFL
LSIYLTKWVLAKDEGPPEMVEISDAIRDGAEGFFRTQYSTISKMAILLAFVILCIYLFRSLTPQQEAAGLGRAMSAYITV
AAFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGIAILYSTFYVWLGVGSPGS
MNVTDLPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE
SIAAEIISAMILGGTMAKKCKIEDPSGFILFPLVVHSFDLIISSIGILSIKGTRDASVKSPVEDPMAVLQKGYSLTIILA
VITFGASTRWLLYTEQAPSAWFNFALCGLVGIITAYIFVWISKYYTDYKHEPVRTLALASSTGHGTNIIAGVSLGLESTA
LPVLTISVAIISAYWLGNTSGLVDENGIPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIADNAGGIVEMSQQPESVREIT
DLLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSAFANVSFKEVDIAIPEVFVGGLLGAMLIFLFSAWACAAVGRT
AQEVVNEVRRQFIERPGIMEYKEKPDYSRCVAIVASAALREMIKPGALAIASPIVVGLVFRILGYYTGQPLLGAKVVASM
LMFATVCGILMALFLNTAGGAWDNAKKYIETGALGGKGSEAHKAAVTGDTVGDPFKDTAGPSIHVLIKMLATITLVMAPV
FL*

DNA
ATGATGATGGATGAAGATGTTGAGCAGGCCAGTTTGATGTCTTTCAATGACAGGCCTAGGGCTTTTCCCAACATGCGTAG
TAAAACCTATAGTCCACTGATATTCCGGATTATTAGGAAATTAAATGTCCGTGTCCTTTCGATAATTCTGCTTTTCTGCT
TCGGAGCAATCTTTTACATGGGGGCAAGTACTTCTCCCATCATCGTGTTCGTCTTCACAGTATGCATCATCAGCTTCCTT
TTGTCAATATATCTAACCAAGTGGGTTTTAGCGAAAGATGAAGGACCTCCAGAGATGGTTGAGATATCAGATGCTATACG
TGATGGAGCTGAAGGTTTTTTCAGAACGCAGTATAGCACTATATCCAAGATGGCCATTTTGCTAGCTTTTGTGATTCTTT
GCATATATCTATTCCGTAGCTTAACTCCCCAGCAAGAGGCTGCTGGTTTAGGAAGGGCGATGTCTGCTTATATTACTGTT
GCTGCATTTCTTTTGGGGGCTCTATGCTCAGGTATTGCTGGATATGTTGGAATGTGGGTGTCAGTTCGTGCTAATGTGCG
GGTCTCCAGTGCTGCCAGACGATCTGCGAGAGAAGCATTGCAGATAGCCGTTCGTGCTGGTGGGTTTTCAGCCCTGGTTG
TTGTTGGTATGGCTGTGATTGGTATCGCCATCCTCTATTCTACATTTTATGTGTGGTTGGGCGTGGGTTCACCAGGCTCA
ATGAATGTTACTGACCTACCTCTTCTTCTTGTCGGATATGGTTTTGGTGCTTCGTTTGTTGCCTTATTTGCTCAGTTGGG
TGGTGGAATATATACTAAGGGAGCTGATGTTGGGGCAGATCTCGTTGGGAAAGTTGAGCAGGGAATTCCCGAGGATGATC
CTCGAAATCCTGCTGTTATTGCTGATTTGGTTGGAGACAATGTGGGGGACTGTGCTGCTAGAGGTGCTGATTTATTTGAA
AGTATAGCTGCAGAAATCATCAGTGCAATGATACTAGGTGGAACAATGGCTAAGAAGTGCAAAATTGAAGATCCATCAGG
CTTTATCCTTTTTCCTCTAGTTGTTCATTCTTTTGACTTGATTATATCCTCAATTGGTATTCTATCAATCAAGGGAACAC
GTGATGCTAGTGTGAAATCTCCGGTAGAGGATCCAATGGCTGTACTTCAGAAAGGATATTCTCTGACAATTATATTAGCT
GTTATAACATTTGGCGCGTCGACTCGCTGGCTGCTTTACACTGAACAAGCTCCATCTGCATGGTTCAATTTCGCCCTATG
TGGGTTGGTTGGCATCATCACAGCCTATATCTTTGTCTGGATATCCAAATATTATACAGACTATAAGCACGAGCCTGTTC
GGACGTTGGCTCTTGCTAGCTCGACTGGTCATGGGACTAATATCATTGCTGGAGTAAGCTTGGGCCTGGAATCAACTGCT
CTTCCAGTTTTGACTATAAGTGTAGCTATTATTTCTGCGTATTGGTTGGGCAATACCTCGGGTCTAGTGGACGAAAATGG
TATTCCCACTGGAGGTCTATTTGGAACAGCCGTTGCTACAATGGGAATGCTAAGCACTGCAGCTTATGTCCTTACTATGG
ACATGTTTGGCCCCATAGCTGACAACGCTGGTGGGATTGTCGAGATGAGCCAGCAGCCAGAGAGTGTCCGTGAGATCACT
GATCTTCTTGATGCTGTTGGGAACACCACAAAAGCAACAACGAAAGGGTTTGCCATTGGATCTGCTGCACTTGCATCATT
CCTTCTCTTTAGTGCGTATATGGACGAGGTTTCAGCGTTTGCTAATGTGTCTTTCAAAGAGGTTGATATTGCTATCCCAG
AAGTGTTCGTTGGTGGATTATTGGGTGCCATGCTTATTTTCCTCTTTAGTGCTTGGGCATGCGCGGCAGTTGGTCGAACT
GCACAAGAGGTTGTCAACGAAGTAAGAAGGCAATTTATTGAGAGGCCTGGCATAATGGAGTACAAGGAGAAGCCAGATTA
TAGTCGCTGTGTCGCCATAGTCGCATCTGCAGCTTTAAGAGAAATGATAAAGCCAGGAGCTTTAGCTATTGCATCACCCA
TTGTAGTTGGTTTGGTGTTTCGAATCTTGGGTTACTACACAGGACAACCTCTGCTCGGAGCAAAAGTTGTAGCTTCTATG
CTCATGTTTGCAACAGTTTGTGGTATCTTAATGGCACTTTTCCTAAACACGGCGGGAGGTGCTTGGGACAATGCAAAGAA
ATACATAGAGACCGGGGCACTTGGGGGCAAAGGAAGTGAAGCTCACAAAGCAGCTGTGACTGGTGATACCGTGGGAGATC
CGTTCAAGGACACAGCCGGTCCATCCATTCACGTCCTCATAAAAATGCTTGCGACTATAACTCTCGTCATGGCTCCGGTT
TTCCTCTGA