Details for Arabidopsis Locus AT1G78880

Position : Chr1 ( 5`- 29652633 .. 29655949 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78880

Protein [Map View]
MGSRYASHQLSNGLFVSGRPEQPKEKPPTMSSVAMPYTGGDIKKSGELGKMFDIPTDGTKSRKSGPITGGSSRSGAQSGP
VPNATGRMSGNLASAGSNSMKKTNSGPLSKHGEPLKKSSGPQSGGVTRQNSGPIPILPTTGLITSGPITSGPLNSSGAPR
KISGPLDYSGSMKTHMPSVVHNQAVTTLAPEDDFSCMKSFPKPVLWLVILIFVMGFLAGGFILGAVHNAILLIVVAVLFT
VVAALFIWNISCERRGITDFIARYPDADLRTAKNGQYVKVTGVVTCGNVPLESSFHRVPRCVYTSTCLYEYRGWGSKPAN
ASHRRFTWGLRSAERHVVDFYISDFQSGLRALVKTGNGAKVTPLVDDSVVIDFKPGNEQASPDFVRWLGKKNLTNDDRIM
RLKEGYIKEGSTVSVIGVVQRNDNVLMIVPTTEPLAAGWQWSKCTFPASLEGIVLRCEDSSNVDAIPV*

DNA
ATGGGTTCGAGATACGCATCTCACCAGCTCAGCAATGGGCTTTTTGTGTCTGGCCGGCCAGAGCAACCCAAAGAAAAGCC
TCCAACAATGAGCTCAGTAGCCATGCCATACACCGGTGGTGATATCAAGAAATCAGGAGAATTGGGGAAGATGTTTGACA
TTCCGACTGATGGGACTAAGTCAAGGAAGTCTGGCCCCATAACCGGAGGATCGTCAAGAAGTGGTGCGCAATCAGGTCCA
GTGCCTAATGCAACTGGTCGTATGTCTGGCAATTTAGCTTCTGCTGGTTCAAATTCAATGAAGAAAACAAATTCTGGGCC
TTTGTCTAAGCATGGGGAGCCTTTAAAGAAATCCTCTGGTCCGCAATCCGGTGGTGTAACAAGGCAAAATTCCGGCCCTA
TTCCTATACTCCCAACTACAGGTCTCATAACATCTGGGCCAATTACCTCGGGGCCTCTAAATTCATCTGGGGCTCCTAGG
AAAATTTCTGGTCCTCTAGACTATTCTGGTTCGATGAAGACACATATGCCTTCAGTTGTCCACAACCAGGCGGTAACTAC
CCTTGCTCCGGAAGATGACTTTTCCTGCATGAAAAGCTTCCCCAAGCCTGTGCTGTGGCTGGTTATACTTATATTTGTGA
TGGGGTTCCTCGCTGGAGGCTTCATTCTTGGAGCAGTTCACAATGCAATTCTCCTCATAGTTGTGGCGGTCTTGTTCACA
GTTGTTGCTGCACTTTTCATTTGGAATATTTCTTGTGAAAGACGTGGTATCACAGATTTCATCGCTCGTTATCCGGATGC
TGATCTTAGAACTGCCAAAAACGGTCAATATGTGAAGGTCACTGGGGTGGTCACCTGTGGTAACGTGCCTCTTGAATCAT
CCTTCCATAGAGTTCCTAGGTGTGTTTACACGTCTACTTGTCTATATGAGTACCGTGGATGGGGTTCAAAGCCAGCCAAT
GCTTCACATCGTCGCTTTACATGGGGACTGAGATCAGCAGAGAGGCATGTGGTAGACTTCTACATTTCTGATTTCCAATC
TGGGCTCAGGGCATTGGTCAAAACTGGAAACGGTGCAAAGGTAACACCGCTTGTCGATGATTCTGTTGTCATCGATTTTA
AGCCAGGAAATGAGCAAGCCTCTCCAGACTTTGTAAGGTGGTTGGGTAAAAAGAATCTAACCAATGATGATCGAATAATG
CGGCTTAAAGAAGGGTATATCAAAGAAGGAAGCACAGTAAGTGTGATTGGAGTGGTTCAGAGAAACGATAACGTGTTAAT
GATAGTCCCGACGACAGAACCATTAGCAGCTGGTTGGCAATGGAGTAAGTGCACATTCCCTGCAAGTCTTGAAGGAATTG
TATTGAGATGCGAAGATTCATCGAACGTAGATGCAATTCCTGTCTGA