Details for Arabidopsis Locus AT1G78820

Position : Chr1 ( 5`- 29634124 .. 29635813 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78820

Protein [Map View]
MLRFDYLLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLAL
RVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQ
SFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTDHDFRGTVTFAVTREFD
NLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLKAFSYFPAATYLEWEET
FAFFSNYFVRQCGLPTFCGDYGYCDRGMCVGCPTPKGLLAWSDKCAPPKTTQFCSGGKGKAVNYYKIVGVEHFTGPYVND
GQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY*

DNA
ATGCTTAGGTTTGATTACTTACTAATCACGGCACTTGCCATTTCAACTGTTTCGGTTGTCATGGCCCAAGTCCCTCCCGA
GAAACAATTCAGAGTGCTCAACGAACCCGGCTACGCCCCATACATCACCGAGTACGACGCGAGTTACCGATTCCTCAACT
CACCGAATCAGAATTTCTTCACAATTCCTTTCCAGCTCATGTTTTACAATACAACTCCTAGCGCCTACGTGTTAGCTCTC
CGAGTCGGAACGAGGCGTGACATGAGTTTCACGCGTTGGATCTGGGACGCCAATCGCAACAACCCCGTCGGAGACAACTC
CACACTCTCATTCGGCCGAAACGGAAACCTTGTGCTCGCTGAGTTAAACGGCCAAGTCAAGTGGCAGACTAACACAGCCA
ACAAAGGCGTCACCGGATTCCAAATCTTGCCCAATGGAAACATGGTGCTACACGACAAACATGGAAAATTCGTTTGGCAG
AGTTTCGATCATCCCACCGATACACTCCTCGTCGGCCAATCCCTAAAAGTTAACGGAGTTAACAAACTCGTTAGCCGTAC
ATCTGATATGAACGGCTCCGATGGTCCGTACAGCATGGTGTTGGACAACAAAGGCTTAACCATGTACGTTAACAAAACCG
GTACGCCGTTAGTTTACGGGGGATGGACGGATCACGACTTCCGCGGTACCGTCACGTTCGCCGTTACAAGAGAGTTCGAT
AATTTAACGGAGCCGTCAGCTTACGAGCTTCTCTTAGAACCCGCACCACAACCCGCTACGAACCCGGGTAATAACCGCCG
GTTACTCCAAGTTAGACCAATCGGAAGCGGAGGAGGAACTTTAAACTTAAACAAAATCAACTACAATGGAACGATATCGT
ATCTGAGACTTGGATCCGACGGTAGCCTCAAGGCCTTCTCGTATTTCCCTGCCGCGACGTATCTCGAATGGGAAGAGACT
TTCGCTTTCTTCTCCAATTACTTCGTCCGTCAATGCGGTTTGCCGACGTTTTGCGGCGATTACGGTTACTGCGATCGAGG
AATGTGCGTCGGGTGCCCTACACCGAAAGGTCTGTTAGCTTGGAGTGATAAATGCGCTCCACCTAAAACGACGCAGTTTT
GCAGCGGAGGCAAGGGTAAAGCTGTCAATTATTACAAGATAGTCGGTGTTGAGCATTTTACTGGGCCGTATGTTAATGAT
GGACAAGGCCCAACTTCTGTGAACGATTGCAAGGCTAAGTGCGATCGTGATTGCAAGTGTTTGGGTTACTTCTACAAGGA
GAAGGACAAGAAATGTTTGCTTGCTCCTCTTCTTGGTACACTTATCAAAGATGCCAACACTTCTTCCGTTGCTTACATCA
AATATTAG