Details for Arabidopsis Locus AT1G78815

Position : Chr1 ( 5`- 29631743 .. 29632745 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78815

Protein [Map View]
MASHSNKGKGIAEGSSQPQSQPQPQPHQPQSPPNPPALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYL
DQFGKTKVHIHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG
VPYKKRKKRKKRNPMKSHDGEDGTTGTSSSSNLAS*

DNA
ATGGCTAGTCATAGCAACAAAGGCAAAGGCATAGCAGAAGGATCGTCTCAACCGCAATCGCAACCGCAACCACAACCACA
CCAACCGCAATCACCTCCTAACCCGCCAGCGTTAAGCCGGTACGAGTCACAGAAACGACGAGACTGGAACACGTTTTGTC
AATACCTGCGTAACCAACAGCCACCGGTTCACATCTCGCAGTGTGGATCAAACCACATCCTCGATTTCCTCCAATATCTC
GACCAGTTTGGGAAGACAAAGGTTCATATCCATGGATGCGTTTTCTTCGGACAGGTTGAGCCAGCGGGACAGTGTAACTG
TCCTTTAAAACAAGCGTGGGGGAGTTTAGATGCTTTGATCGGACGGCTAAGAGCGGCTTTCGAGGAGAACGGAGGATTGC
CGGAGAGAAACCCTTTTGCCGGCGGCGGAATTAGGGTTTTTCTGAGGGAAGTGAGAGATTCACAGGCGAAGGCAAGAGGA
GTTCCGTACAAGAAAAGAAAAAAGAGGAAGAAGAGGAATCCTATGAAGAGTCATGATGGTGAAGATGGTACTACGGGAAC
TAGTAGTAGCTCCAACTTGGCTTCTTAG