Details for Arabidopsis Locus AT1G78800

Position : Chr1 ( 5`- 29625659 .. 29627989 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78800

Protein [Map View]
MAKKEGSKMNIAIIHPDLGIGGAERLIVDAAVELASHGHKVHIFTSHHDKSRCFEETLSGIFQVTVYGSFLPRHIFYRLH
AVCAYLRCLFVALCVLLGWSSFDVVLADQVSVVVPLLKLKRSSKVVFYCHFPDLLLAKHTTTLRRMYRKPIDFIEEQTTG
MADMILVNSNFTASTFANTFKRLNAQGSRPAVLYPAVNIDQFIEPHTYKLNFLSINRFERKKNIDLAVSAFAILCKHKQN
LSDVTLTVAGGYDERLKENVEYLEELRSLAEKEGVSDRVNFITSCSTAERNELLSSCLCVLYTPTDEHFGIVPLEAMAAY
KPVIACNSGGPVETVKNGVTGYLCEPTPEDFSSAMARFIENPELANRMGAEARNHVVESFSVKTFGQKLNQYLVDVVSSP
KED*

DNA
ATGGCGAAAAAAGAAGGTTCAAAGATGAACATCGCCATTATACATCCAGATCTTGGAATAGGCGGAGCAGAGAGATTGAT
TGTTGATGCGGCCGTTGAGCTTGCCTCGCACGGTCATAAAGTTCATATCTTCACCTCTCACCACGACAAATCCAGATGCT
TCGAGGAAACTCTTTCCGGTATCTTTCAAGTTACGGTGTATGGATCTTTCCTGCCACGGCATATTTTCTACCGACTACAC
GCAGTGTGTGCATATTTGCGGTGCTTGTTTGTTGCTCTCTGTGTTCTTTTGGGTTGGTCTTCATTCGATGTTGTACTAGC
AGACCAAGTTTCAGTCGTAGTCCCATTGCTGAAACTCAAAAGGTCATCTAAGGTTGTTTTCTACTGCCATTTCCCGGATC
TCTTGCTAGCTAAGCATACAACAACACTTAGACGGATGTATCGGAAACCCATTGATTTCATTGAAGAACAAACAACAGGG
ATGGCTGATATGATCCTTGTTAACAGTAACTTCACGGCATCAACATTTGCCAATACATTTAAAAGGCTAAATGCACAAGG
GAGTCGCCCAGCTGTACTTTACCCCGCAGTCAATATTGATCAGTTCATTGAACCCCACACTTATAAGTTGAATTTCCTCT
CCATAAACCGCTTTGAGAGGAAAAAGAACATCGATCTAGCTGTTTCAGCTTTTGCTATCCTATGCAAACATAAGCAAAAT
CTGAGTGATGTTACCCTTACCGTTGCAGGTGGATATGACGAGCGATTGAAGGAGAATGTTGAGTACTTGGAGGAGCTCAG
AAGTTTAGCCGAGAAAGAAGGAGTTTCTGATCGAGTTAACTTTATCACATCTTGTTCAACCGCTGAAAGAAATGAACTTC
TCTCAAGCTGCTTGTGCGTTCTCTACACCCCCACGGATGAACATTTTGGTATTGTTCCATTAGAAGCAATGGCTGCATAC
AAACCCGTGATAGCCTGCAACAGTGGTGGCCCCGTGGAGACGGTAAAGAATGGAGTAACAGGCTATCTTTGTGAACCAAC
TCCAGAAGATTTCAGTTCGGCGATGGCTAGATTCATCGAGAATCCTGAGTTGGCGAATAGAATGGGAGCTGAAGCCAGGA
ACCATGTCGTTGAATCATTCTCTGTGAAGACGTTTGGACAGAAGTTGAATCAGTATCTCGTTGATGTCGTATCAAGTCCT
AAAGAAGATTGA