Details for Arabidopsis Locus AT1G78700

Position : Chr1 ( 5`- 29599349 .. 29601682 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78700

Protein [Map View]
MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPVER
MEIGGGSATASPCSSYQPSPCASYNPSPGSSNFMSPASSSFANLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIP
GGSISAPVTPPLSSPTARTPRMNTDWQQLNNSFFVSSTPPSPTRQIIPDSEWFSGIQLAQSVPASPTFSLVSQNPFGFKE
EAASAAGGGGGSRMWTPGQSGTCSPAIPPGADQTADVPMSEAVAPPEFAFGSNTNGLVKAWEGERIHEESGSDDLELTLG
NSSTR*

DNA
ATGACATCAGGGACGAGAATGCCGACATGGAGGGAAAGAGAGAACAACAAGAGAAGAGAAAGACGACGGAGAGCAATCGC
AGCTAAGATCTTCACCGGATTAAGAATGTACGGTAATTACGAGCTTCCGAAGCATTGCGACAACAACGAAGTGCTTAAAG
CACTCTGTAACGAAGCTGGTTGGATCGTCGAACCTGATGGAACTACTTACCGCAAGGGATGTAGTAGACCTGTAGAGCGT
ATGGAGATAGGTGGTGGTTCAGCAACCGCTAGTCCTTGCTCTTCCTATCAGCCAAGTCCCTGTGCTTCTTATAATCCTAG
TCCAGGCTCCTCCAACTTCATGAGTCCTGCTTCATCCTCATTTGCTAATCTTACCTCTGGTGATGGCCAATCTCTCATCC
CATGGCTAAAACACCTCTCAACAACATCATCCTCATCAGCTTCTTCATCATCAAGACTCCCTAATTACCTCTATATCCCT
GGAGGCTCCATAAGCGCTCCTGTAACTCCTCCTTTAAGCTCTCCAACAGCTCGTACCCCGAGAATGAACACTGATTGGCA
GCAACTCAACAACTCCTTCTTTGTCTCCTCAACACCGCCAAGTCCCACGCGTCAGATCATCCCTGACTCTGAATGGTTCT
CAGGGATTCAACTAGCACAAAGTGTTCCAGCTTCACCAACGTTTAGCCTCGTCTCACAAAACCCATTTGGATTCAAAGAA
GAAGCAGCCTCTGCTGCTGGAGGCGGAGGAGGGTCAAGGATGTGGACACCAGGTCAAAGCGGAACCTGCTCCCCTGCTAT
TCCTCCTGGTGCTGACCAGACAGCAGATGTTCCAATGTCTGAAGCCGTGGCTCCTCCAGAGTTTGCTTTTGGGAGTAATA
CAAACGGGCTAGTGAAAGCATGGGAAGGAGAGAGGATACACGAGGAGAGTGGTTCAGATGATCTTGAACTCACTCTTGGA
AACTCAAGCACCAGGTAA