Details for Arabidopsis Locus AT1G78660

Position : Chr1 ( 5`- 29585677 .. 29588302 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78660

Protein [Map View]
MIDNNCLYKEELNRNSYSGLAKEASESILLPSESGFDGSRSPVCSSPDPNLNYRPVIGILSHPGDGASGRLTNDTSSTYI
AASYVKFAEAGGARVIPLIYNEPEEVLFQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFE
LMSIIISQNRDILERFDAEDNASSLQFVDNVNNDGTLFQRFPPELLKKLSTDCLVMQKHKYGITPANFQANPALSSFFEI
LTTCIDENSKTYVSTVKAKRYPITGFQWHPEKNAFEWGSSAIPHSEDAIQVTQHAASYLVSEARKSLNRPESQKVLSNLI
YNYKPTYCGYAGRGYDEVYIFTQPRSRF*

DNA
ATGATCGACAACAATTGTTTATATAAAGAAGAGCTGAATCGCAATTCTTACTCAGGTCTGGCCAAGGAGGCTTCTGAGTC
GATTTTGCTCCCTAGTGAATCCGGATTTGACGGTTCTCGGAGTCCGGTTTGCTCCTCGCCGGATCCGAACCTCAACTACA
GACCTGTCATCGGTATCCTGAGTCACCCTGGAGATGGTGCGTCTGGTCGGTTGACCAATGATACGAGCTCGACGTACATC
GCTGCTTCGTATGTGAAGTTCGCTGAGGCAGGTGGTGCTCGTGTTATCCCACTCATCTACAACGAACCTGAAGAAGTGCT
CTTCCAGAAGCTAGAGTTGGTCAACGGTGTGATATTCACTGGTGGTTGGGCTAAAAAATATGATTATTTCGAGATCGTCA
AAAAAATCTTCACTAAAGCTTTGGAGAGAAATGATGCTGGAGAGCATTTCCCAGTATATGGCATTTGCCTCGGATTCGAG
CTTATGTCAATTATCATAAGTCAGAACAGAGACATTCTTGAAAGATTTGATGCAGAGGATAATGCATCAAGTCTCCAGTT
TGTTGATAATGTTAATAACGATGGAACATTATTCCAAAGATTTCCGCCAGAGTTGTTGAAAAAACTCAGTACAGATTGTT
TGGTTATGCAGAAACACAAGTATGGTATCACACCAGCAAACTTTCAAGCCAATCCTGCTTTGTCTAGTTTCTTTGAAATT
CTCACAACCTGCATTGATGAAAACAGCAAGACTTATGTTTCAACTGTTAAAGCAAAGAGATACCCAATAACTGGCTTCCA
GTGGCATCCTGAGAAAAATGCATTTGAATGGGGATCATCTGCGATTCCACACTCTGAGGATGCAATCCAGGTGACACAGC
ATGCTGCTAGTTATTTAGTCAGTGAAGCTAGGAAGTCACTGAACAGACCAGAGTCTCAGAAAGTGCTGAGCAATCTCATT
TACAACTATAAGCCTACTTACTGTGGATACGCAGGGAGGGGTTACGACGAGGTTTACATTTTTACACAACCAAGATCCCG
TTTCTAA