Details for Arabidopsis Locus AT1G78630

Position : Chr1 ( 5`- 29575956 .. 29577658 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78630

Protein [Map View]
MAVLCSSSTVILSSSSVKSSGSERKSPFLGFSLTAISKPSVRVGIYANSKRGLQVKCEAEPTTTTSLVPANQRWMFDEEE
ANGPDIWNTTWYPKASDHVNTDKPWFVVDATDKILGRLASTIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRN
QKLYRRHSGRPGGMTVETFDQLQQRIPERIVEHAVRGMLPKGRLGRALFNHLKVYKGPDHPHEAQKPLDLPIRDKRIQLQ
K*

DNA
ATGGCGGTTCTTTGCTCGTCTTCGACGGTGATACTCTCTTCTTCTTCCGTGAAATCCTCCGGAAGTGAGAGAAAGTCTCC
GTTTTTAGGGTTCTCTTTAACGGCTATCTCGAAGCCGTCGGTACGAGTCGGCATTTATGCGAATTCGAAAAGAGGATTGC
AAGTGAAGTGTGAAGCTGAGCCGACGACGACGACTTCTCTTGTTCCGGCGAATCAACGATGGATGTTCGACGAAGAAGAA
GCTAATGGCCCTGACATCTGGAACACGACATGGTATCCAAAAGCTTCAGACCATGTGAACACGGACAAGCCCTGGTTTGT
GGTTGATGCAACTGACAAAATTCTTGGTAGATTGGCATCGACAATTGCTAATCACATCCGTGGGAAGAATCTTGCCTCTT
ACACTCCTAGTGTCGACATGGGAGCTTTTGTGATTGTGGTGAATGCTGAGAAAGTTGCTGTATCTGGAAAGAAGCGTAAC
CAAAAGCTGTACAGGAGGCATTCAGGACGACCTGGTGGTATGACAGTAGAGACATTTGATCAATTGCAGCAGAGAATTCC
TGAAAGAATCGTTGAGCATGCTGTTCGTGGAATGCTTCCAAAGGGACGGCTTGGGAGAGCTCTGTTCAATCACCTGAAGG
TGTACAAAGGCCCTGACCATCCTCACGAGGCCCAGAAACCGCTTGATCTGCCTATCAGGGACAAGAGAATACAGCTGCAA
AAATAG