Details for Arabidopsis Locus AT1G78620

Position : Chr1 ( 5`- 29572871 .. 29575794 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78620

Protein [Map View]
MATISSTLLLNSSRSALPLRFPKFSGFSSSSPFARSYRFGRRNLEPLSNGMLSSGSRADGATAAAASMEGVMTEAMKLIQ
SASPTWKSAVANNLLIFVLGSPLLVTGLSASGIAAAFLLGTLTWRAYGSAGFLLVAAYFVIVSAFVINLNGTAATKVKMT
QKEAQGVAEKRKGRRGPRSVIGSSAAGCVCAFLSIYQVGGAAFSQLFRLGFVSSFCTKVSDTVSSEIGKAYGKTTYLATT
FKIVPRGTEGAMSLEGTLAGLLASFFLASVGCFLGQITPPEAAVCVLASQIANLGESIIGASFQDKEGFKWLNNDVVNVI
NISLGSIVAILMQQFILQNWVK*

DNA
ATGGCAACGATTTCGTCAACTCTACTCTTAAATTCTTCTAGATCAGCTTTACCACTAAGATTCCCAAAATTCTCGGGATT
TTCTTCTTCCTCTCCATTCGCTAGATCTTACAGATTTGGACGACGTAATCTGGAACCACTTTCCAACGGAATGCTTTCGT
CGGGAAGTAGAGCCGACGGTGCTACGGCGGCGGCTGCATCGATGGAAGGAGTGATGACGGAGGCGATGAAACTGATTCAA
TCGGCGTCACCAACTTGGAAATCAGCTGTGGCTAACAATTTATTGATTTTTGTTCTCGGTTCACCGCTTCTTGTTACCGG
ATTGTCCGCTTCTGGGATCGCCGCCGCGTTTTTGCTTGGTACTTTAACTTGGAGAGCTTATGGCTCTGCTGGTTTCCTCT
TAGTCGCTGCTTACTTCGTCATAGTAAGTGCATTTGTGATCAACCTGAATGGAACAGCGGCAACGAAGGTTAAAATGACG
CAAAAGGAAGCACAAGGTGTGGCCGAAAAGAGAAAGGGTAGAAGAGGACCACGCAGTGTGATTGGTTCAAGTGCTGCTGG
TTGTGTCTGTGCTTTTCTTTCAATATATCAAGTGGGAGGAGCAGCTTTTTCCCAGCTTTTCCGGCTTGGTTTTGTTTCCA
GTTTCTGCACTAAAGTATCTGACACTGTCTCGAGCGAGATAGGCAAAGCTTATGGAAAAACAACGTATTTAGCTACGACA
TTTAAGATTGTACCAAGAGGAACAGAGGGAGCTATGAGTCTTGAAGGAACATTGGCTGGACTTTTAGCATCATTTTTTCT
TGCATCTGTTGGCTGCTTCCTGGGTCAGATAACTCCTCCAGAAGCAGCTGTATGTGTACTAGCTTCCCAGATTGCCAATC
TTGGAGAGAGCATAATAGGTGCTTCTTTTCAAGACAAAGAAGGATTCAAATGGCTAAACAATGATGTAGTCAACGTGATC
AACATAAGCTTGGGAAGCATTGTGGCGATTTTGATGCAACAGTTTATACTCCAGAACTGGGTCAAGTAA