Details for Arabidopsis Locus AT1G78580

Position : Chr1 ( 5`- 29552340 .. 29560912 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78580

Protein [Map View]
MPGNKYNCSSSHIPLSRTERLLRDRELREKRKSNRARNPNDVAGSSENSENDLRLEGDSSRQYVEQYLEGAAAAMAHDDA
CERQEVRPYNRQRLLVVANRLPVSAVRRGEDSWSLEISAGGLVSALLGVKEFEARWIGWAGVNVPDEVGQKALSKALAEK
RCIPVFLDEEIVHQYYNGYCNNILWPLFHYLGLPQEDRLATTRSFQSQFAAYKKANQMFADVVNEHYEEGDVVWCHDYHL
MFLPKCLKEYNSKMKVGWFLHTPFPSSEIHRTLPSRSELLRSVLAADLVGFHTYDYARHFVSACTRILGLEGTPEGVEDQ
GRLTRVAAFPIGIDSDRFIRALEVPEVIQHMKELKERFAGRKVMLGVDRLDMIKGIPQKILAFEKFLEENANWRDKVVLL
QIAVPTRTDVPEYQKLTSQVHEIVGRINGRFGTLTAVPIHHLDRSLDFHALCALYAVTDVALVTSLRDGMNLVSYEFVAC
QEAKKGVLILSEFAGAAQSLGAGAILVNPWNITEVAASIGQALNMTAEEREKRHRHNFHHVKTHTAQEWAETFVSELNDT
VIEAQLRISKVPPELPQHDAIQRYSKSNNRLLILGFNATLTEPVDNQGRRGDQIKEMDLNLHPELKGPLKALCSDPSTTI
VVLSGSSRSVLDKNFGEYDMWLAAENGMFLRLTNGEWMTTMPEHLNMEWVDSVKHVFKYFTERTPRSHFETRDTSLIWNY
KYADIEFGRLQARDLLQHLWTGPISNASVDVVQGSRSVEVRAVGVTKGAAIDRILGEIVHSKSMTTPIDYVLCIGHFLGK
DEDVYTFFEPELPSDMPAIARSRPSSDSGAKSSSGDRRPPSKSTHNNNKSGSKSSSSSNSNNNNKSSQRSLQSERKSGSN
HSLGNSRRPSPEKISWNVLDLKGENYFSCAVGRTRTNARYLLGSPDDVVCFLEKLADTTSSP*

DNA
ATGCCTGGAAATAAGTACAACTGCAGTTCTTCTCATATCCCACTCTCTCGAACAGAACGCCTCTTGAGAGATAGAGAGCT
TAGAGAGAAGAGGAAGAGCAACCGAGCTCGTAATCCTAATGACGTTGCTGGCAGTTCCGAGAACTCTGAGAATGACTTGC
GTTTAGAAGGTGACAGTTCAAGGCAGTATGTTGAACAGTACTTGGAAGGGGCTGCTGCTGCAATGGCGCACGATGATGCG
TGTGAGAGGCAAGAAGTTAGGCCTTATAATAGGCAACGACTACTTGTAGTGGCTAACAGGCTCCCAGTTTCTGCCGTGAG
AAGAGGTGAAGATTCATGGTCTCTTGAGATCAGTGCTGGTGGTCTAGTCAGTGCTCTCTTAGGTGTAAAGGAATTTGAGG
CCAGATGGATAGGATGGGCTGGAGTTAATGTGCCTGATGAGGTTGGACAGAAGGCACTTAGCAAAGCTTTGGCTGAGAAG
AGGTGTATTCCCGTGTTCCTTGATGAAGAGATTGTTCATCAGTACTATAATGGTTACTGCAACAATATTCTGTGGCCTCT
GTTTCACTACCTTGGACTTCCGCAAGAAGATCGGCTTGCCACAACCAGAAGCTTTCAGTCCCAATTTGCTGCATACAAGA
AGGCAAACCAAATGTTCGCTGATGTTGTAAATGAGCACTATGAAGAGGGAGATGTCGTCTGGTGCCATGACTATCATCTT
ATGTTCCTTCCTAAATGCCTTAAGGAGTACAACAGTAAGATGAAAGTTGGATGGTTTCTCCATACACCATTCCCTTCGTC
TGAGATACACAGGACACTTCCATCACGATCAGAGCTCCTTCGCTCAGTTCTTGCTGCTGATTTAGTTGGCTTCCATACAT
ATGACTATGCAAGGCACTTTGTGAGTGCGTGCACTCGTATTCTTGGACTTGAAGGAACACCTGAGGGAGTTGAGGATCAA
GGCAGGCTCACTCGTGTAGCTGCTTTTCCAATTGGCATAGATTCTGATCGGTTTATACGAGCACTTGAGGTCCCCGAAGT
CATACAACACATGAAGGAATTGAAAGAAAGATTTGCTGGCAGAAAGGTGATGTTAGGTGTTGATCGTCTTGACATGATCA
AAGGGATTCCACAAAAGATTCTGGCATTCGAAAAATTTCTCGAGGAAAATGCAAACTGGCGTGATAAAGTGGTCTTATTG
CAAATTGCGGTGCCAACAAGAACTGACGTTCCTGAGTATCAAAAACTCACAAGCCAAGTTCATGAAATTGTTGGACGCAT
TAATGGTCGTTTTGGGACACTGACTGCAGTTCCAATACATCATCTGGATCGGTCTCTGGACTTTCATGCTTTATGTGCAC
TTTATGCCGTCACAGATGTTGCGCTTGTAACATCTTTGAGAGATGGGATGAATCTTGTCAGTTATGAGTTTGTTGCTTGC
CAAGAGGCCAAAAAGGGCGTCCTCATTCTCAGTGAATTTGCAGGTGCTGCACAGTCTCTGGGTGCTGGAGCTATTCTTGT
GAATCCTTGGAACATCACAGAAGTTGCTGCCTCCATTGGACAAGCCCTAAACATGACAGCTGAAGAAAGAGAGAAAAGAC
ATCGCCATAATTTTCATCATGTCAAAACTCACACTGCTCAAGAATGGGCTGAAACTTTTGTCAGTGAACTAAATGACACT
GTAATTGAGGCGCAACTACGAATTAGTAAAGTCCCACCAGAGCTTCCACAGCATGATGCAATTCAACGGTATTCAAAGTC
CAACAACAGGCTTCTAATCCTGGGTTTCAATGCAACATTGACTGAACCAGTGGATAATCAAGGGAGAAGAGGTGATCAAA
TAAAGGAGATGGATCTTAATCTACACCCTGAGCTTAAAGGGCCCTTAAAGGCATTATGCAGTGATCCAAGTACAACCATA
GTTGTTCTGAGCGGAAGCAGCAGAAGTGTTTTGGACAAAAACTTTGGAGAGTATGACATGTGGCTGGCAGCAGAAAATGG
GATGTTCCTAAGGCTTACGAATGGAGAGTGGATGACTACAATGCCAGAACACTTGAACATGGAATGGGTTGATAGCGTAA
AGCATGTTTTCAAGTACTTCACTGAGAGAACTCCCAGGTCACACTTTGAAACTCGCGATACTTCGCTTATTTGGAACTAC
AAATATGCAGATATCGAATTCGGGAGACTTCAAGCAAGAGATTTGTTACAACACTTATGGACAGGTCCAATCTCTAATGC
ATCAGTTGATGTTGTCCAAGGAAGCCGCTCTGTGGAAGTCCGTGCAGTTGGTGTCACAAAGGGAGCTGCAATTGATCGTA
TTCTAGGAGAGATAGTGCATAGCAAGTCGATGACTACACCAATCGATTACGTCTTGTGCATTGGTCATTTCTTGGGGAAG
GACGAAGATGTTTACACTTTCTTCGAACCAGAACTTCCATCCGACATGCCAGCCATTGCACGATCCAGACCATCATCTGA
CAGTGGAGCCAAGTCATCATCAGGAGACCGAAGACCACCTTCAAAGTCGACACATAACAACAACAAAAGTGGATCAAAAT
CCTCATCATCCTCTAACTCTAACAACAACAACAAGTCCTCACAGAGATCTCTTCAGTCAGAGAGAAAAAGTGGATCCAAC
CATAGCTTAGGAAACTCAAGACGTCCTTCACCAGAGAAGATCTCATGGAATGTGCTTGACCTCAAAGGAGAGAACTACTT
CTCTTGCGCTGTGGGTCGTACTCGCACCAATGCTAGATATCTCCTTGGCTCACCTGACGACGTCGTTTGCTTCCTTGAGA
AGCTCGCTGACACCACTTCCTCACCTTAA