Details for Arabidopsis Locus AT1G78510

Position : Chr1 ( 5`- 29535285 .. 29537417 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78510

Protein [Map View]
MMTSCRNIDLGTMMMACGCGRRQFPSLAKTVCKFTSSNRSYGGLVGSCKAVPTKSKEISLLNGIGQSQTVSFDLKQESKQ
PISLVTLFELVAVDLQTLNDNLLSIVGAENPVLISAAEQIFGAGGKRMRPGLVFLVSHATAELAGLKELTTEHRRLAEII
EMIHTASLIHDDVLDESDMRRGKETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSL
FDCDTKLDEYLLKSFYKTASLVAASTKGAAIFSRVEPDVTEQMYEFGKNLGLSFQIVDDILDFTQSTEQLGKPAGSDLAK
GNLTAPVIFALEREPRLREIIESEFCEAGSLEEAIEAVTKGGGIKRAQELAREKADDAIKNLQCLPRSGFRSALEDMVLY
NLERID*

DNA
ATGATGACGTCATGTCGGAATATAGATTTAGGTACGATGATGATGGCATGTGGTTGTGGCCGTCGTCAGTTTCCTTCATT
AGCGAAGACTGTTTGTAAGTTTACTAGCAGCAATAGAAGCTATGGCGGTCTGGTGGGGAGTTGCAAAGCGGTGCCAACGA
AATCAAAGGAGATCTCTTTGCTCAATGGTATTGGTCAATCTCAAACAGTGAGTTTTGATTTGAAACAAGAGTCAAAACAG
CCTATTTCGTTGGTGACTCTGTTTGAGCTAGTAGCTGTTGATCTGCAGACTTTGAATGACAATCTTTTATCGATTGTTGG
TGCGGAAAATCCGGTTTTGATATCTGCGGCTGAGCAGATTTTCGGAGCTGGTGGTAAAAGAATGAGACCGGGTTTGGTAT
TCCTTGTATCACATGCCACGGCGGAATTAGCAGGCCTAAAGGAACTAACAACAGAACACCGGCGTTTGGCTGAGATCATC
GAGATGATACACACTGCAAGCTTGATACACGACGATGTGTTAGACGAGAGTGACATGCGAAGAGGAAAGGAAACAGTTCA
TGAGCTTTTCGGCACAAGAGTAGCGGTGCTAGCTGGAGATTTCATGTTTGCTCAAGCGTCATGGTACTTAGCAAATCTCG
AGAATCTTGAAGTTATTAAGCTCATCAGTCAGGTGATCAAAGACTTTGCAAGCGGAGAGATAAAGCAGGCGTCCAGCTTA
TTTGACTGCGACACCAAGCTCGACGAGTACTTACTCAAAAGTTTCTACAAGACAGCCTCTTTAGTGGCTGCGAGCACCAA
AGGAGCTGCCATTTTCAGCAGAGTTGAGCCTGATGTGACAGAACAAATGTACGAGTTTGGGAAGAATCTCGGTCTCTCTT
TCCAGATAGTTGATGATATTTTGGATTTCACTCAGTCGACAGAGCAGCTCGGGAAGCCAGCAGGGAGTGATTTGGCTAAA
GGTAACTTAACAGCACCTGTGATTTTCGCTCTGGAGAGGGAGCCAAGGCTAAGAGAGATCATTGAGTCAGAGTTTTGTGA
GGCGGGTTCTCTGGAAGAAGCGATTGAAGCGGTGACAAAAGGTGGGGGGATTAAGAGAGCACAAGAATTGGCTAGGGAGA
AAGCTGATGACGCTATAAAGAATCTACAGTGTCTACCTCGAAGTGGCTTCAGGTCGGCTCTAGAAGATATGGTGTTGTAT
AACCTCGAAAGAATTGATTAG