Details for Arabidopsis Locus AT1G78470

Position : Chr1 ( 5`- 29521770 .. 29523191 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78470

Protein [Map View]
MLASWIQSLTSMKHTKNLILANFNGRFAPTGEDNVLKLSTETFNHPSLRTLSLYQYILQDAQAFNNCKNLKYLDLFQIFA
EVDVFNEVISSCPSLEVLILQIIFFNPSGHLKIDHKTLRILSMSCNQIDSIEVRAARLDILSIEYIPCESDNVVLEIPRL
QFGRNYWVAGRLLPHTSINISCPPQKQESNGMVKWDTNYATSPASLSVSLDLKNPREVEVLRKILAVWTEKMIEVEISFK
NNNPLGEEGNSSDGGAQNNLWEKAEPFPNADFRVDTIWMHNFKGSNKEQFALASRFVMQKTVMKKMMIKTSFDEKKKKEI
EAAVAKLKELPKGNEELSIECF*

DNA
ATGCTTGCTTCTTGGATCCAATCACTGACTAGTATGAAACACACCAAAAATCTTATCCTTGCAAATTTTAATGGTCGCTT
CGCACCAACAGGTGAAGACAATGTGCTCAAGCTGTCCACAGAGACATTCAACCATCCAAGCCTAAGAACACTCTCGCTAT
ATCAATACATATTACAAGATGCACAAGCTTTTAACAATTGTAAAAATCTCAAGTACCTTGACCTGTTTCAAATCTTTGCT
GAGGTTGATGTTTTCAACGAAGTCATCTCGTCTTGCCCCTCCCTCGAGGTTCTTATCCTACAAATCATTTTCTTCAACCC
CAGTGGTCATTTGAAGATTGATCATAAAACGTTAAGGATCTTGTCCATGTCATGCAACCAAATTGATAGCATTGAAGTGC
GTGCAGCTCGTCTTGATATTCTCTCCATAGAATATATCCCATGTGAGAGTGATAACGTCGTTCTCGAAATTCCTAGACTC
CAGTTTGGTAGAAACTATTGGGTAGCAGGAAGACTCTTGCCTCATACTAGCATCAACATCTCATGTCCCCCTCAGAAGCA
AGAAAGCAACGGGATGGTGAAGTGGGATACCAACTATGCAACATCACCTGCATCTTTATCTGTGAGTTTAGATTTGAAGA
ATCCTCGAGAAGTAGAAGTGCTAAGGAAAATCTTAGCTGTGTGGACTGAAAAAATGATAGAAGTTGAAATATCATTTAAG
AATAACAATCCTCTTGGGGAAGAAGGCAATTCTTCTGACGGTGGAGCACAAAACAATTTATGGGAGAAGGCAGAACCGTT
TCCCAATGCTGACTTTCGTGTGGATACTATATGGATGCACAATTTCAAGGGTTCAAATAAAGAACAATTTGCACTAGCGT
CGCGTTTCGTGATGCAAAAGACAGTAATGAAGAAGATGATGATTAAGACATCATTTGATGAAAAGAAGAAGAAAGAGATA
GAAGCGGCAGTTGCCAAGCTAAAGGAACTTCCAAAAGGTAACGAGGAGCTTAGTATCGAATGCTTCTAA