Details for Arabidopsis Locus AT1G78440

Position : Chr1 ( 5`- 29511599 .. 29513051 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78440

Protein [Map View]
MAVLSKPVAIPKSGFSLIPVIDMSDPESKHALVKACEDFGFFKVINHGVSAELVSVLEHETVDFFSLPKSEKTQVAGYPF
GYGNSKIGRNGDVGWVEYLLMNANHDSGSGPLFPSLLKSPGTFRNALEEYTTSVRKMTFDVLEKITDGLGIKPRNTLSKL
VSDQNTDSILRLNHYPPCPLSNKKTNGGKNVIGFGEHTDPQIISVLRSNNTSGLQINLNDGSWISVPPDHTSFFFNVGDS
LQVMTNGRFKSVRHRVLANCKKSRVSMIYFAGPSLTQRIAPLTCLIDNEDERLYEEFTWSEYKNSTYNSRLSDNRLQQFE
RKTIKNLLN*

DNA
ATGGCGGTATTGTCTAAACCGGTAGCAATACCAAAATCCGGGTTCTCTCTAATCCCGGTTATAGATATGTCTGACCCAGA
ATCCAAACATGCCCTCGTGAAAGCATGCGAAGACTTCGGCTTCTTCAAGGTGATCAACCATGGCGTTTCCGCAGAGCTAG
TCTCTGTTTTAGAACACGAGACCGTCGATTTCTTCTCGTTGCCCAAGTCAGAGAAAACCCAAGTCGCAGGTTATCCCTTC
GGATACGGGAACAGTAAGATTGGTCGGAATGGTGACGTGGGTTGGGTTGAGTACTTGTTGATGAACGCTAATCATGATTC
CGGTTCGGGTCCACTATTTCCAAGTCTTCTCAAAAGCCCGGGAACTTTCAGAAACGCATTGGAAGAGTACACAACATCAG
TGAGAAAAATGACATTCGATGTTTTGGAGAAGATCACAGATGGGCTAGGGATCAAACCGAGGAACACACTTAGCAAGCTT
GTGTCTGACCAAAACACGGACTCGATATTGAGACTTAATCACTATCCACCATGTCCTCTTAGCAATAAGAAAACCAATGG
TGGTAAGAATGTGATTGGTTTTGGTGAACACACAGATCCTCAAATCATCTCTGTCTTAAGATCTAACAACACTTCTGGTC
TCCAAATTAATCTAAATGATGGCTCATGGATCTCTGTCCCTCCCGATCACACTTCCTTCTTCTTCAACGTTGGTGACTCT
CTCCAGGTGATGACAAATGGGAGGTTCAAGAGCGTGAGGCATAGGGTTTTAGCTAACTGTAAAAAATCTAGGGTTTCTAT
GATTTACTTCGCTGGACCTTCATTGACTCAGAGAATCGCTCCGTTGACATGTTTGATAGACAATGAGGACGAGAGGTTGT
ACGAGGAGTTTACTTGGTCTGAATACAAAAACTCTACCTACAACTCTAGATTGTCTGATAATAGGCTTCAACAATTCGAA
AGGAAGACTATAAAAAATCTCCTAAATTGA