Details for Arabidopsis Locus AT1G78420

Position : Chr1 ( 5`- 29504532 .. 29507669 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78420

Protein [Map View]
MGNKLGRKRQVVEERYTKPQGLYVNKDVDVKKLRKLIVESKLAPCYPGDDESCHDLEECPICFLYYPSLNRSRCCMKSIC
TECFLQMKNPNSARPTQCPFCKTPNYAVEYRGVKSKEEKGIEQVEEQRVIEAKIRMRQKEMQDDEEKMQKRLESCSSSTS
AMTGEMEYGSTSAISYNSLMDDGEIAPSQNASVVRQHSRPRGNREDEVDVDLEELMVMEAIWLSVQETGTQRNSASGEIT
SSRQYVTDNHSYVSSPPRVTPIVEPATPSSSSGGLSCAISALAERQMVGESSSHNHNHNVNVSSYSMLPGNCDSYYDIEQ
EVDGIDNHHHHRHHYEMGETGSSNSYVSSYMTGEGFHNFPPPPPLVIVPESFEEQMMMAMAVSMAEVHATTTCAPTEVTW
Q*

DNA
ATGGGTAATAAGTTGGGAAGGAAGAGGCAAGTGGTGGAAGAAAGGTATACAAAGCCTCAAGGTTTGTATGTGAATAAAGA
TGTCGACGTTAAAAAGCTCAGAAAACTGATTGTGGAGTCTAAGCTTGCTCCTTGCTATCCTGGAGACGATGAAAGCTGTC
ATGATCTTGAAGAATGTCCAATTTGTTTTCTGTACTATCCTAGCCTCAATAGATCAAGATGTTGCATGAAAAGCATTTGT
ACAGAGTGTTTTTTGCAAATGAAGAATCCTAATTCAGCTCGGCCTACTCAGTGCCCTTTTTGTAAAACTCCCAACTATGC
TGTCGAGTATCGTGGAGTCAAGTCAAAGGAGGAAAAGGGCATTGAACAAGTTGAAGAGCAACGGGTAATAGAAGCCAAAA
TAAGGATGAGGCAGAAAGAAATGCAGGATGATGAAGAGAAAATGCAGAAACGTCTTGAATCATGTTCCTCTAGCACAAGC
GCAATGACTGGCGAGATGGAATATGGTTCAACTTCAGCCATATCTTATAACTCCCTCATGGATGACGGGGAAATTGCTCC
ATCGCAGAACGCATCTGTTGTTAGACAACATTCCCGCCCGCGAGGAAACAGGGAGGATGAGGTTGACGTTGACCTTGAGG
AATTGATGGTCATGGAAGCAATATGGCTCTCTGTTCAGGAAACAGGGACGCAGAGAAATTCAGCTTCAGGGGAAATTACC
TCTTCTAGGCAGTATGTAACAGATAATCATAGTTATGTTTCTTCACCACCACGAGTGACTCCAATCGTAGAACCAGCAAC
ACCGTCTTCATCATCTGGTGGGCTTTCTTGTGCAATCTCCGCACTTGCTGAACGCCAAATGGTTGGCGAATCCTCCAGTC
ACAATCATAATCACAATGTCAACGTTTCTTCATACAGTATGCTTCCCGGAAATTGTGACAGTTACTACGACATAGAACAA
GAGGTAGATGGCATAGACAACCATCATCATCATCGTCATCATTACGAGATGGGAGAAACAGGAAGCAGCAACAGCTATGT
AAGTTCTTACATGACAGGCGAGGGCTTCCACAACTTTCCTCCTCCTCCACCTCTGGTCATTGTTCCAGAGAGTTTTGAGG
AACAGATGATGATGGCTATGGCTGTGTCTATGGCAGAGGTTCATGCCACGACGACATGTGCACCAACTGAAGTTACCTGG
CAATAA