Details for Arabidopsis Locus AT1G78310

Position : Chr1 ( 5`- 29463656 .. 29465053 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78310

Protein [Map View]
MDKSCNSSGDSSAVSASATSSTGNNTTNRDHYLRQLNKLSHKISKPTNSSSSVSVANREIDLPPPPPLQINQGNLHQHQP
PVYNINKNDFRDVVQKLTGSPAHERISAPPQQPIHHPKPQQSSRLHRIRPPPLVHVINRPPGLLNDALIPQGSHHMNQNW
TGVGFNLRPTAPLSPLPPLPPVHAAAESPVSSYMRYLQNSMFAIDSNRKEFSGLSPLAPLVSPRWYQQQENAPPSQHNSF
PPPHPPPPSSAVSQTVPTSIPAPPLFGCSSSPKSPYGLLSPSILLSPSSGQLGFPVSPTTVPLPSPKYKGH*

DNA
ATGGATAAGAGCTGTAACTCCTCCGGCGATTCCTCCGCCGTATCCGCCTCTGCAACGAGTAGTACCGGTAACAATACAAC
GAACAGAGATCATTACCTGAGACAACTCAATAAGCTGTCTCATAAGATATCAAAACCGACGAACTCTTCCTCCTCCGTCT
CCGTCGCGAATCGTGAAATTGATCTTCCACCTCCTCCACCGCTGCAAATCAATCAAGGGAATCTCCATCAACATCAACCT
CCTGTTTACAATATCAACAAGAACGATTTCAGAGATGTTGTTCAGAAACTAACCGGTTCACCTGCACATGAACGGATCTC
TGCTCCGCCGCAACAACCGATTCATCACCCTAAACCTCAACAGAGTTCGCGTCTACATAGGATCCGTCCTCCTCCTTTGG
TTCACGTTATCAATCGTCCTCCTGGTTTGCTAAATGACGCACTTATCCCTCAAGGTTCTCATCACATGAATCAAAACTGG
ACTGGCGTTGGATTTAACCTTCGACCAACGGCGCCGCTTTCTCCTCTCCCGCCGTTACCACCGGTTCACGCGGCGGCGGA
ATCACCGGTCTCTTCGTACATGCGGTATCTCCAGAACTCGATGTTCGCAATCGATTCGAATCGGAAAGAGTTCTCTGGAT
TATCTCCGTTAGCTCCTTTGGTCTCACCTCGTTGGTACCAACAACAGGAAAACGCTCCACCATCGCAGCATAACAGTTTT
CCACCACCACATCCTCCTCCTCCTTCCTCTGCTGTTTCGCAGACGGTGCCGACATCGATTCCGGCGCCTCCACTGTTTGG
ATGTTCAAGTTCGCCTAAATCTCCGTACGGATTACTCTCACCGAGCATACTTTTATCGCCATCGTCAGGTCAATTAGGGT
TCCCTGTATCTCCGACGACGGTGCCGCTTCCTAGCCCTAAATACAAAGGTCATTGA