Details for Arabidopsis Locus AT1G78220

Position : Chr1 ( 5`- 29425721 .. 29427181 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78220

Protein [Map View]
MENEREKLIYLAKLGCQAGRYDDVMKSMRKVCELDIELSEEERDLLTTGYKNVMEAKRVSLRVISSIEKMEDSKGNDQNV
KLIKGQQEMVKYEFFNVCNDILSLIDSHLIPSTTTNVESIVLFNRVKGDYFRYMAEFGSDAERKENADNSLDAYKVAMEM
AENSLAPTNMVRLGLALNFSIFNYEIHKSIESACKLVKKAYDEAITELDGLDKNICEESMYIIEMLKYNLSTWTSGDGNG
NKTDG*

DNA
ATGGAGAATGAGAGAGAAAAGCTGATTTACTTGGCTAAGCTCGGTTGCCAAGCTGGAAGATATGATGATGTGATGAAATC
GATGAGAAAAGTATGTGAGCTTGATATAGAGCTAAGTGAAGAGGAAAGAGACCTACTAACAACTGGATACAAGAATGTCA
TGGAGGCTAAGAGAGTTTCATTGAGAGTAATATCATCCATTGAAAAAATGGAAGACTCGAAAGGAAACGACCAAAATGTG
AAACTGATAAAAGGACAACAAGAAATGGTTAAATATGAGTTTTTCAATGTTTGTAATGACATTTTGTCTCTCATTGATTC
TCATCTCATACCATCAACTACTACTAATGTCGAATCAATTGTCCTTTTTAACAGAGTGAAAGGAGATTATTTTCGATATA
TGGCAGAGTTTGGTTCTGATGCTGAACGTAAAGAAAATGCAGATAATTCTCTAGATGCATATAAGGTTGCAATGGAAATG
GCAGAGAATAGTTTAGCACCCACCAATATGGTTAGACTTGGATTGGCTTTAAATTTCTCGATATTCAATTATGAGATCCA
TAAATCTATTGAAAGCGCATGTAAATTGGTTAAGAAAGCTTACGATGAAGCAATCACTGAACTCGATGGCCTTGACAAGA
ATATATGCGAAGAGAGCATGTATATCATAGAGATGCTTAAATACAATCTTTCTACGTGGACTTCAGGCGATGGTAATGGT
AATAAGACAGACGGTTAG