Details for Arabidopsis Locus AT1G78140

Position : Chr1 ( 5`- 29401759 .. 29403946 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78140

Protein [Map View]
MPMTVVSGRFSTALLPTCFSLSRLHSVKYAAQRRVVFVSRSAHASSASVSVETNSNSNVDFVIEKKDKNRGEKKILACPI
CYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNETHLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNFI
WGGFPGPEKEFEMAKAYLKPVLGGNIIDASCGSGMFSRLFTRSDLFSLVIALDYSENMLRQCYELLNKEENFPNKEKLVL
VRADIARLPFLSGSVDAVHAGAALHCWPSPSSAVAEISRVLRPGGVFVATTFIYDGPFSFIPFLKNLRQEIMRYSGSHIF
LNERELEDICKACGLVNFTRVRNGPFIMLSATKPS*

DNA
ATGCCGATGACGGTTGTTTCCGGTCGATTCTCAACGGCGTTGCTCCCTACTTGCTTTTCCTTGTCGCGGTTGCATTCCGT
CAAGTACGCCGCTCAAAGACGGGTTGTTTTCGTTTCCAGATCAGCTCACGCCTCTTCAGCCTCCGTCTCCGTTGAGACAA
ATTCGAATTCGAATGTGGATTTTGTTATCGAGAAGAAGGATAAGAACAGAGGAGAGAAGAAGATTCTAGCTTGTCCCATC
TGTTATAACTCCTTAGCATGGATTAGTCAACCTAATGGATTAATAGAATCTGCTGCCTCTGGTATTCAAGTACAATGCAA
TACATGTAAAAGGAGTTACTCGGGTAATGAGACGCATCTTGATTTGGCTGTTGCTAGTGGAAGCAAGAGATACAGTGAAC
CGATGCCTCTTTCCACTGAGTTATTTAGGACTCCACTGGTCTCGTTTCTCTATGAGAGGGGTTGGCGTCAGAATTTCATA
TGGGGAGGTTTTCCAGGACCAGAGAAAGAGTTTGAAATGGCTAAGGCCTATCTGAAGCCTGTTTTGGGAGGCAATATCAT
TGATGCTAGTTGTGGAAGTGGGATGTTCTCGAGGTTATTCACTAGAAGTGATCTATTTTCTCTGGTTATTGCTCTAGATT
ACTCAGAGAATATGCTGCGACAATGCTATGAACTCTTAAATAAAGAAGAAAACTTTCCCAACAAAGAGAAACTTGTTCTA
GTCCGAGCTGACATTGCTAGACTCCCTTTCCTTTCGGGTTCAGTTGACGCTGTCCATGCTGGTGCTGCTCTGCATTGCTG
GCCTTCACCATCCTCAGCCGTTGCTGAGATAAGCCGTGTTCTTAGACCTGGAGGAGTATTTGTGGCCACCACATTTATCT
ATGACGGTCCATTCAGTTTTATCCCCTTCTTGAAGAATCTTCGTCAGGAAATAATGAGATATTCAGGTTCTCACATTTTC
CTAAATGAACGTGAGCTTGAAGATATCTGCAAAGCCTGTGGTCTCGTTAACTTCACTCGTGTTAGAAACGGGCCATTTAT
AATGCTATCTGCAACAAAACCCAGCTAA