Details for Arabidopsis Locus AT1G78110

Position : Chr1 ( 5`- 29391827 .. 29393334 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78110

Protein [Map View]
MIKGNNGNRGSSSSGYSADLLVCFPSRTHLALTPKPICSPSRPSDSSTNRRPHHRRQLSKLSGGGGGGHGSPVLWAKQAS
SKNMGGDEIAEPTSPKVTCAGQIKVRPSKCGGRGKNWQSVMEEIERIHDNRSQSKFFGLKKDVMGFLTCLRNIKFDFRCF
GDFRHADVTSDDDEEEDDDDDEEEEVVEGEEEENSKTVFSKWFMVLQEEQNNKDDDKNNNKCDEKRDLEDTETEPAVPPP
NALLLMRCRSAPAKSWLEERMKVKTEQEKREEQKEEKETEDQETSMKTKKKDLRSLMEEEKMELVLMRYDTEFYRLSSDI
AKETWVVGGIQDPLSRSRSWKN*

DNA
ATGATCAAAGGAAACAATGGAAACAGAGGATCTTCTTCTTCTGGTTACTCTGCAGATTTGTTGGTTTGTTTCCCTTCAAG
AACCCACTTAGCTCTGACTCCTAAGCCCATTTGTAGCCCATCTCGTCCCTCAGACTCTTCCACTAACCGTCGTCCTCACC
ACCGTCGCCAGCTCAGTAAACTCTCCGGCGGCGGTGGAGGAGGACACGGTAGTCCTGTTTTGTGGGCTAAACAAGCAAGT
AGTAAGAATATGGGAGGTGACGAAATAGCAGAACCAACTTCTCCTAAAGTAACTTGCGCAGGTCAGATCAAAGTCCGGCC
AAGTAAATGCGGAGGGAGAGGAAAGAACTGGCAATCGGTGATGGAAGAGATTGAGAGGATACATGATAATAGATCGCAAA
GCAAGTTTTTTGGGTTGAAGAAAGATGTGATGGGTTTCTTGACTTGTCTTAGAAACATCAAATTCGATTTCAGGTGTTTT
GGTGATTTCCGACATGCTGATGTCACTAGCGACGACGATGAGGAAGAAGATGATGATGATGATGAGGAAGAAGAGGTAGT
GGAAGGAGAAGAAGAAGAGAATTCAAAGACTGTTTTCTCTAAATGGTTTATGGTTTTACAAGAGGAACAGAACAACAAAG
ATGACGACAAGAACAACAACAAGTGTGATGAGAAACGCGATCTTGAAGACACAGAGACAGAACCAGCGGTTCCGCCGCCA
AACGCGCTTTTGTTGATGCGGTGTAGATCAGCTCCAGCGAAGAGTTGGTTAGAAGAGAGAATGAAAGTAAAAACAGAGCA
AGAAAAGAGAGAAGAACAAAAAGAGGAAAAAGAAACAGAGGATCAAGAAACGAGTATGAAGACAAAGAAGAAGGATTTGA
GATCATTAATGGAAGAAGAGAAGATGGAATTGGTGTTGATGAGATACGATACTGAGTTTTACAGACTCTCTTCAGACATA
GCTAAGGAAACTTGGGTTGTCGGAGGAATTCAAGATCCTCTGTCTCGGAGTCGAAGCTGGAAAAATTGA