Details for Arabidopsis Locus AT1G78100

Position : Chr1 ( 5`- 29387795 .. 29389112 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78100

Protein [Map View]
MDAFDAIPDPVVIDILNRVGDVKTLIRCRSVSKRFNSLATQSESLLLQLDQILGATESDSEIDSPIASFFRSLFKSIHGL
LPPIFSKPANSDEILTRSPKTPAQILSGFERIRNLEVELYGGDVKLEKGAAVKWKAEFGKTLKSCVIVAFRSATVNTSAA
TEAAAVVDGVVESDSEFVCGLKTRVVWTISALMAASTRHYLMRDLVKDHKEMEKLIVRDSDGEGTVVMDAAGMKEYRETE
VRGDNKESERVGERTVVPSVRMSMRHAPSLMLKSGICLEAATLVVVRPTGVASDDNDVELVTEAFAGDGDDCMYGEAVTA
LLKRRRNVLEMNSF*

DNA
ATGGACGCTTTTGATGCGATTCCAGATCCTGTGGTCATCGACATTTTGAACAGAGTCGGTGACGTCAAAACGTTAATACG
ATGTCGTTCCGTTTCTAAACGATTCAACTCGTTAGCCACTCAGTCTGAGTCGCTCCTTCTCCAACTCGATCAGATCCTCG
GAGCCACCGAATCTGACTCCGAGATCGATTCTCCTATCGCTAGCTTCTTCCGATCTCTCTTCAAATCCATTCACGGTCTC
CTTCCTCCTATCTTCTCCAAACCAGCTAACTCTGACGAAATCCTAACCCGATCTCCGAAAACTCCGGCTCAGATTCTCTC
CGGATTTGAACGGATCCGGAATCTGGAGGTGGAATTATACGGTGGTGATGTCAAGCTTGAGAAAGGCGCCGCCGTTAAGT
GGAAGGCTGAGTTCGGGAAAACTCTCAAGAGCTGCGTCATCGTCGCTTTCCGTTCCGCGACGGTTAATACTTCAGCAGCT
ACGGAAGCTGCCGCCGTCGTCGACGGTGTTGTTGAGTCAGATTCGGAGTTTGTTTGTGGATTGAAGACGCGCGTGGTGTG
GACGATCAGCGCGTTGATGGCGGCTTCCACGCGTCATTACTTGATGAGAGATTTGGTGAAAGATCACAAGGAGATGGAGA
AATTGATTGTGCGTGACAGTGATGGTGAAGGTACGGTGGTGATGGACGCGGCGGGGATGAAAGAATACAGAGAGACGGAG
GTGCGTGGGGATAATAAAGAATCAGAGCGCGTGGGGGAACGAACTGTGGTACCTAGCGTGAGGATGAGTATGAGACACGC
GCCGTCGCTGATGCTGAAGAGCGGGATTTGTCTCGAAGCAGCGACGCTGGTGGTCGTAAGGCCGACTGGTGTGGCTTCCG
ATGATAACGATGTTGAGCTGGTGACGGAGGCGTTCGCCGGAGATGGCGACGATTGTATGTACGGAGAAGCTGTTACGGCG
TTGCTTAAGCGTAGGAGAAATGTGTTAGAGATGAATTCTTTCTAA