Details for Arabidopsis Locus AT1G78080

Position : Chr1 ( 5`- 29364249 .. 29366073 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78080

Protein [Map View]
MAAAMNLYTCSRSFQDSGGELMDALVPFIKSVSDSPSSSSAASASAFLHPSAFSLPPLPGYYPDSTFLTQPFSYGSDLQQ
TGSLIGLNNLSSSQIHQIQSQIHHPLPPTHHNNNNSFSNLLSPKPLLMKQSGVAGSCFAYGSGVPSKPTKLYRGVRQRHW
GKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDKAAYKLRGDFARLNFPNLRHNGSHIGGDFGEYKPLHSSVDAKLEAICK
SMAETQKQDKSTKSSKKREKKVSSPDLSEKVKAEENSVSIGGSPPVTEFEESTAGSSPLSDLTFADPEEPPQWNETFSLE
KYPSYEIDWDSILA*

DNA
ATGGCAGCTGCTATGAATTTGTACACTTGTAGCAGATCGTTTCAAGACTCTGGTGGTGAACTCATGGACGCGCTTGTACC
TTTTATCAAAAGCGTTTCCGATTCTCCTTCTTCTTCTTCTGCAGCGTCTGCGTCTGCGTTTCTTCACCCCTCTGCGTTTT
CTCTCCCTCCTCTCCCCGGTTATTACCCGGATTCAACGTTCTTGACCCAACCGTTTTCATACGGGTCGGATCTTCAACAA
ACCGGGTCATTAATCGGACTCAACAACCTCTCTTCTTCTCAGATCCACCAGATCCAGTCTCAGATCCATCATCCTCTTCC
TCCGACGCATCACAACAACAACAACTCTTTCTCGAATCTTCTCAGCCCAAAGCCGTTACTGATGAAGCAATCTGGAGTCG
CTGGATCTTGTTTCGCTTACGGTTCAGGTGTTCCTTCGAAGCCGACGAAGCTTTACAGAGGTGTGAGGCAACGTCACTGG
GGAAAATGGGTGGCTGAGATCCGTTTGCCGAGAAATCGGACTCGTCTCTGGCTTGGGACTTTTGACACGGCGGAGGAAGC
TGCGTTGGCCTATGATAAGGCGGCGTACAAGCTGCGCGGCGATTTCGCCCGGCTTAACTTCCCTAACCTACGTCATAACG
GATCTCACATCGGAGGCGATTTCGGTGAATATAAACCTCTTCACTCCTCAGTCGACGCTAAGCTTGAAGCTATTTGTAAA
AGCATGGCGGAGACTCAGAAACAGGACAAATCGACGAAATCATCGAAGAAACGTGAGAAGAAGGTTTCGTCGCCAGATCT
ATCGGAGAAAGTGAAGGCGGAGGAGAATTCGGTTTCGATCGGTGGATCTCCACCGGTGACGGAGTTTGAAGAGTCCACCG
CTGGATCTTCGCCGTTGTCGGACTTGACGTTCGCTGACCCGGAGGAGCCGCCGCAGTGGAACGAGACGTTCTCGTTGGAG
AAGTATCCGTCGTACGAGATCGATTGGGATTCGATTCTAGCTTAG