Details for Arabidopsis Locus AT1G78050

Position : Chr1 ( 5`- 29347581 .. 29349755 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78050

Protein [Map View]
MATSTTMSHQAIGSVVSQRPFKASQFLKEPLNNVPMKFRQKRFKIEATASQISVVDNTFLSPSPSKNKPHESKKKSNEAA
LILIRHGESLWNEKNLFTGCVDVPLTQKGVGEAIEAGKKISNIPVDLIFTSSLIRAQMTAMLAMTQHRRKKVPIILHNES
VKAKTWSHVFSEETRKQSIPVIAAWQLNERMYGELQGLNKKETAERYGTQQVHEWRRSYEIPPPKGESLEMCAERAVAYF
EDNIKPELASGNNVMIAAHGNSLRSIIMYLDDLTSQEVTTLDLSTGVPLLYIFKEGKFMKRGSPVGSTEAGVYAYTKRLA
QYREKLDAAATI*

DNA
ATGGCTACTTCTACGACTATGTCTCATCAAGCGATTGGGTCTGTTGTCTCTCAAAGACCATTCAAAGCTTCTCAGTTTCT
AAAGGAGCCTTTGAATAATGTACCAATGAAATTCAGACAAAAAAGATTCAAGATTGAAGCAACTGCTTCTCAGATATCTG
TCGTTGACAACACTTTCTTGTCTCCGTCTCCTTCCAAGAACAAACCACATGAATCTAAGAAGAAATCAAATGAAGCAGCT
TTGATATTGATTAGGCATGGAGAATCGTTATGGAATGAGAAGAATTTGTTCACGGGTTGTGTTGATGTGCCATTGACTCA
GAAAGGTGTTGGAGAAGCTATTGAAGCTGGGAAGAAGATTAGTAACATTCCTGTAGATTTGATTTTCACTTCTTCTTTAA
TCCGTGCTCAGATGACTGCAATGCTTGCCATGACTCAGCATCGTCGCAAGAAGGTTCCAATCATCTTGCACAACGAGAGT
GTAAAGGCGAAAACTTGGAGTCATGTTTTCAGCGAAGAAACTAGAAAACAATCTATCCCGGTTATAGCGGCTTGGCAACT
GAATGAGAGAATGTATGGAGAGTTGCAGGGTTTGAACAAGAAAGAAACAGCGGAAAGATACGGGACACAACAAGTTCACG
AATGGCGCAGGAGTTACGAAATTCCTCCTCCGAAAGGCGAGAGCTTGGAGATGTGTGCTGAGAGAGCAGTGGCTTATTTT
GAAGACAATATCAAACCAGAGCTTGCATCTGGAAACAATGTAATGATTGCTGCTCACGGGAACTCATTGAGATCTATCAT
TATGTATCTTGACGATTTAACTTCTCAGGAGGTTACAACTCTAGACCTGTCCACAGGTGTACCATTGCTCTACATCTTCA
AAGAAGGCAAGTTCATGAAACGAGGAAGCCCCGTCGGTTCTACTGAAGCTGGTGTCTATGCTTATACAAAGAGATTGGCA
CAATACAGAGAGAAGCTTGATGCGGCGGCGACCATTTAA