Details for Arabidopsis Locus AT1G78040

Position : Chr1 ( 5`- 29345838 .. 29347107 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78040

Protein [Map View]
MAKLVMLLVLCILPAIAMAARRGNIGKNTMVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSD
KEGKYKFIVHDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDVFCSALFQKYMV
DEDEDDIKNHL*

DNA
ATGGCGAAACTGGTGATGTTGTTGGTTCTCTGTATCTTACCGGCGATAGCCATGGCGGCAAGGAGGGGAAATATTGGAAA
GAATACAATGGTGGTTCAAGGTAGCACCTACTGTGACATTTGCAAATTCGGCTTCGAGACTCCTGAATCCTCCTACTTCA
TCCCCGGTGCAACGGTGAAGCTATCATGCAAAGACAGGAAGACAATGGAAGAGGTTTACACAGACAAAGCTGTATCAGAC
AAAGAAGGAAAGTATAAGTTCATTGTCCACGACGATCACAGAGACCAGATGTGCGATGTTTTGCTTGTGAAAAGCTCGGA
TAAAACCTGCTCTAAAATCTCCGTTGGACGTGAGAAGTCTCGTGTGATCTTGAACCATTACAGTGGCATTGCCTCGCAGA
TCAGACATGCTAACAACATGGGATTTGAGAAAGAAGTGAGTGATGTGTTCTGCTCTGCTTTGTTTCAGAAGTATATGGTT
GATGAAGATGAGGATGATATTAAAAACCATCTCTAA