Details for Arabidopsis Locus AT1G78020

Position : Chr1 ( 5`- 29338693 .. 29339755 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78020

Protein [Map View]
MLLGKRQRPPINRTTSLSEIKFDLNLPSESEPSNQQKPTVASPYGSNGQAVTAAVDQNRGFLDQRLLSMVTPRGNLRRHS
GDFSDAGHFLRSCALCERLLVPGRDIYMYRGDKAFCSSECRQEQMAQDERKEKGKSAAPAKEPAVTAPARAKPGKGRAAA
AV*

DNA
ATGTTGCTTGGAAAGAGACAACGACCACCGATCAACAGAACCACAAGTCTATCGGAGATAAAGTTCGATCTAAACCTTCC
CAGCGAGTCAGAGCCATCAAATCAACAGAAGCCAACCGTTGCGAGCCCGTACGGTTCCAACGGTCAAGCTGTAACAGCAG
CCGTTGATCAAAACCGTGGGTTCTTAGATCAACGGCTCTTATCCATGGTCACACCGAGAGGTAACCTGAGGAGACACTCA
GGCGATTTCTCCGACGCTGGACATTTCTTGAGATCTTGCGCACTTTGTGAACGCCTTCTTGTTCCTGGCCGCGACATCTA
TATGTATAGGGGAGATAAGGCTTTTTGTAGCTCAGAGTGCAGGCAAGAGCAAATGGCACAAGATGAGAGGAAAGAGAAAG
GTAAATCGGCGGCACCGGCGAAAGAACCGGCGGTGACAGCTCCCGCGAGAGCGAAACCCGGCAAAGGGAGAGCTGCAGCC
GCCGTGTAA