Details for Arabidopsis Locus AT1G78010

Position : Chr1 ( 5`- 29333500 .. 29336451 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G78010

Protein [Map View]
MVSLLCFRSVGVYLLRQATPIITRGGRISRPISKNLCFVLFSSSPKTSLLKPRAQSSENNSLVFKGDERVVGLVGKVVDD
AFDKVDRFQSSSTIVAIVTPIGGPPGAVGIVRLSGPKAVEVARRVFRSAKKTKKKESDSDTWRPKSHFVEYGAVVDSNGN
VVDEVLAVPMLAPRSYTREDVVELQCHGSEVCLRRVLRTCVEAGARLAEPGEFTLRAFLNGRLDLSQAENVEKLISAKSS
AAADAALEGIQGGFSSLVKSLRAQCIELLTEIEARLDFEDEMPPLDIESVINKITSMSQDVESALDTANYDKLLQSGLQI
AIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEANVTVRGVPITLLDTAGIRETNDIVEKIGVERSETAAKVADVI
IMAVSAVEGWTEEDTELLRKIQSDKPMILVMNKIDCAPPGSCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEIL
GLDRVPTGGHQWTVNQRQCEQLVRTKEALVRLREAIEDEIPIDFWTIELREAALSLAQISGQDVSEEVLSSIFAKFCIGK
*

DNA
ATGGTGAGTCTCCTCTGCTTCCGTTCAGTCGGCGTTTATCTTCTCCGACAAGCTACGCCGATTATAACCCGAGGCGGAAG
AATCTCGAGACCCATCTCTAAAAATCTCTGCTTTGTTTTATTCTCTTCGTCTCCTAAAACCTCTCTTCTTAAACCTCGCG
CTCAGTCATCAGAGAACAATTCTCTTGTGTTTAAAGGCGATGAGCGTGTGGTGGGTCTTGTGGGCAAGGTAGTAGACGAT
GCATTCGATAAAGTTGATAGGTTTCAGAGCTCAAGTACTATTGTGGCGATCGTAACGCCGATTGGTGGACCACCTGGTGC
GGTGGGAATTGTGCGGTTGTCAGGTCCTAAGGCTGTGGAAGTTGCTAGAAGAGTCTTTCGTTCTGCTAAGAAAACGAAGA
AGAAGGAGTCTGATTCGGATACGTGGCGGCCCAAGAGTCATTTTGTGGAGTATGGAGCTGTTGTTGATTCAAATGGCAAT
GTTGTTGACGAGGTTTTAGCTGTGCCTATGTTGGCTCCTCGGTCATACACTCGTGAAGATGTAGTTGAGCTCCAATGTCA
CGGGAGCGAAGTTTGTCTGCGGCGTGTTTTGAGGACATGTGTTGAAGCTGGAGCACGATTAGCAGAACCAGGAGAGTTCA
CACTTCGTGCCTTTCTAAATGGGCGTTTAGACCTTTCGCAAGCTGAAAATGTCGAAAAACTTATTTCGGCCAAGTCTTCT
GCTGCCGCAGATGCTGCTTTGGAAGGGATTCAGGGAGGTTTTTCATCTTTGGTCAAATCCTTAAGAGCACAATGCATTGA
GCTCCTCACTGAAATTGAAGCTCGTTTAGACTTTGAGGACGAGATGCCACCATTGGATATAGAGTCAGTTATTAACAAAA
TAACCAGCATGTCTCAAGACGTAGAAAGTGCATTAGATACAGCAAACTATGACAAGCTTCTTCAAAGCGGATTGCAGATA
GCTATTGTTGGACGTCCCAATGTCGGGAAATCAAGTCTTCTAAATGCCTGGAGCAAAAGTGAGAGAGCCATTGTTACAGA
AGTTGCTGGAACTACTCGAGACGTTGTGGAAGCTAATGTTACAGTCCGCGGCGTGCCTATCACACTTCTTGACACTGCTG
GTATCAGAGAAACCAATGACATTGTCGAAAAAATAGGAGTTGAAAGATCAGAAACAGCTGCTAAGGTTGCTGATGTCATA
ATCATGGCTGTGAGTGCTGTCGAAGGCTGGACTGAAGAAGACACTGAGCTTCTACGTAAGATCCAATCAGACAAGCCTAT
GATTCTGGTGATGAACAAAATTGACTGTGCTCCTCCTGGTAGCTGTGATCAACTAGAAGATCAGAGGAAAAAGGAAGAAG
TTTTCCATAAGTCTGTCTTCACTTCTGCTGTAACTGGTCAAGGAATTGAAGAGCTTGAAGATGCAATATTGGAGATTCTT
GGTCTTGATCGTGTCCCCACTGGAGGACATCAATGGACTGTGAATCAGAGACAATGCGAGCAATTGGTGCGGACGAAAGA
AGCGCTAGTGAGGCTGAGAGAAGCTATCGAAGACGAGATTCCGATTGATTTCTGGACGATCGAGCTTAGAGAAGCTGCTT
TATCTCTTGCTCAAATCAGTGGTCAAGATGTCTCTGAAGAGGTTTTATCTTCCATTTTTGCTAAGTTTTGCATTGGTAAA
TAA