Details for Arabidopsis Locus AT1G77990

Position : Chr1 ( 5`- 29317899 .. 29323352 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77990

Protein [Map View]
MQLSSLSHTSITHKDKKKKMGIELQNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNS
SSNLVYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGTSRELA
IGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQAIFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLK
GLFGLTHFTNKTDVVSVLSSVFHSLHHPWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSN
AESRGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMGFMNIAG
SLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLTRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDK
LDFLVLIAAFFGVLFASVEIGLLLAVGISFARIMLSSIRPSIEALGRLSKTDIFGDINQYPMANKTAGLLTLRISSPLLC
FANANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELASNDIRLVIASPRWRVLHK
LKRAKLDEKIKTENIYMTVGEAVDIYVRARSTSHELC*

DNA
ATGCAACTTAGTTCCCTATCACACACTTCAATAACCCACAAAGATAAAAAAAAAAAAATGGGCATAGAGCTTCAGAATCA
CCAGAGCCACCATGAAGAAGCCAGTCCTGCAGAAGAGCCCATGTCACGGTGGCTGATAAATACGCCGGAACCACCAAGCA
TGTGGCAAGAGCTTATTGGGTACATAAGAACAAATGTCTTGGCCAAGAAGAAACATAAGAGGAACAAGACGAAGAACTCA
TCATCAAACCTTGTTTACTCTTGTCTTAAATCGGCTTTCCCTATACTTAGTTGGGGAAGACAATACAAACTCAACTTGTT
CAAGAAAGATTTGATGGCAGGTCTCACTCTCGCTAGTCTTTGCATTCCTCAGAGTATAGGATATGCTAATTTGGCTGGAC
TTGATCCAGAGTACGGTCTATATACAAGTGTGGTACCACCTCTGATATATTCGACGATGGGAACTTCGAGAGAGTTAGCC
ATTGGTCCTGTGGCTGTAGTTTCGCTTCTTCTGTCGTCAATGGTTCGTGACCTTCAAGATCCAGTCACCGACCCAATTGC
TTACCGAAAAATTGTCTTCACTGTCACGTTTTTCGCTGGCGCGTTTCAAGCCATCTTTGGACTCTTCAGGTTAGGGTTTT
TGGTGGACTTTTTGTCACATGCTGCACTTGTTGGGTTCATGGCTGGTGCTGCAATTGTCATTGGTTTACAACAACTTAAA
GGTTTATTTGGTTTGACTCATTTTACCAATAAAACCGATGTAGTTTCGGTTTTATCTTCGGTTTTCCACTCGCTTCACCA
TCCGTGGCAACCTCTGAACTTTGTCATCGGTAGCTCATTCCTCATCTTCATCCTCCTAGCTAGATTTATCGGAAAAAGAA
ACAATAAGTTGTTTTGGATTCCAGCGATGGCACCGCTAATATCAGTTGTATTAGCAACACTAATAGTGTATTTATCCAAT
GCTGAGTCACGAGGGGTTAAGATTGTTAAACACATTAAACCAGGGTTTAACCAGCTTTCAGTTAACCAATTACAATTCAA
AAGTCCACATCTTGGTCAAATCGCCAAAATTGGTCTTATTTCTGCAATCATCGCCCTAACGGAAGCAATCGCAGTGGGAA
GATCGTTTGCGACGATCAAAGGATATCGTTTGGATGGGAACAAAGAGATGATGGCTATGGGATTTATGAATATCGCTGGT
TCTTTATCTTCTTGCTATGTAGCTACCGGGTCTTTCTCAAGAACGGCGGTGAATTTCAGTGCTGGTTGCGAGACGGTGGT
TTCAAACATTGTAATGGCGATTACAGTGATGATTTCACTAGAAGTTTTGACGAGGTTTCTCTACTTCACACCAACGGCGA
TTCTTGCCTCCATAATCCTCTCGGCGCTTCCAGGTCTCATTGATGTCTCTGGTGCTTTACACATTTGGAAACTCGATAAA
CTCGATTTTCTCGTCCTCATTGCCGCCTTCTTCGGCGTCCTCTTTGCCTCCGTCGAGATCGGTCTTCTTCTCGCCGTGGG
GATATCGTTTGCAAGAATAATGTTGAGTTCGATAAGACCAAGCATTGAGGCCTTAGGGAGGTTATCAAAAACAGATATCT
TCGGTGACATAAATCAGTATCCAATGGCAAATAAGACTGCAGGATTATTGACTCTTCGAATCAGTTCTCCTTTGCTATGC
TTTGCTAATGCCAATTTTATAAGAGACAGAATATTGAATTCAGTTCAAGAAATAGAAGGAGAGGAGAATGAACAAGAAGT
TCTAAAAGAAAATGGTCTTCAAGTAGTAATTCTCGACATGTCTTGCGTGATGGGCGTAGATACATCAGGAGTATTTGCAC
TTGAAGAACTACATCAAGAGCTAGCTTCTAATGACATCCGGTTAGTCATCGCTAGTCCCAGATGGAGGGTACTTCACAAA
TTGAAGCGAGCAAAATTGGACGAGAAAATAAAGACAGAAAATATATATATGACAGTAGGAGAAGCCGTAGATATTTATGT
AAGAGCAAGATCTACGTCCCACGAGTTGTGTTGA