Details for Arabidopsis Locus AT1G77960

Position : Chr1 ( 5`- 29310057 .. 29313571 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77960

Protein [Map View]
MSGDMFDDQSPLLSPLCFLESPEPCIPLLDCLPNSTVETEKPYVDPFGLVPVSTIDETNLLLSSQQSNLVTYQETSTLVP
KPLEMHQNQNQNQHQHQNQNQHQHQHQYQNQHQHQYQNQHQHRVVQQQQQQQLINSHETWLQDKLSNMLNTIQQESSVFT
RNQTEIGQQVRQANNGFAHPTVTNSPLQLQNRFLPVPLIPQHRSNAFGSLFPQTMGSARPQNYMPYQTPHQQVSSSFGMY
PQQPRPPVFVRRQNEPPNIRMVNNNALTRIHPLQNQTNMIPPFNAVPQRTIPRPQMSSRLFTRQHGGMQTSVNQSPLRFR
LPNINNRQAPVRPNANAIIPPQGEILGCRRRSYPSRFEFGQSSSSSAQRRRIVPASENVGSTSINHGNAEQRGTNTIYDP
RYESFGLCIDPHLRKYAMTL*

DNA
ATGTCTGGCGATATGTTCGATGACCAATCGCCGTTGTTGAGTCCTTTATGTTTTCTTGAATCACCGGAACCGTGTATTCC
GTTATTGGATTGCCTGCCGAATTCAACAGTAGAAACCGAAAAACCGTATGTTGACCCTTTTGGATTGGTACCCGTCTCTA
CAATAGACGAAACTAACCTCTTGTTATCCTCTCAACAATCAAATCTAGTCACATATCAAGAGACATCAACTCTGGTACCA
AAACCACTTGAAATGCACCAGAATCAGAACCAGAACCAGCACCAACATCAAAACCAAAATCAACATCAACACCAACACCA
ATACCAGAACCAGCACCAACACCAATACCAGAACCAGCACCAGCACCGTGTTGTACAACAACAACAACAACAACAACTAA
TCAATTCGCATGAGACGTGGTTACAGGATAAGTTATCAAACATGTTGAATACTATTCAGCAGGAGTCGAGTGTTTTTACA
AGGAACCAAACAGAGATTGGTCAACAAGTGAGGCAAGCAAATAATGGATTTGCACATCCAACTGTGACGAATTCTCCACT
TCAACTTCAAAACCGTTTTCTTCCAGTACCTTTGATACCTCAACACCGTTCTAATGCATTTGGATCACTTTTTCCTCAAA
CTATGGGATCCGCTAGGCCACAGAACTATATGCCATATCAGACGCCTCATCAACAAGTCAGTTCTTCCTTTGGCATGTAT
CCACAGCAACCGCGCCCACCAGTGTTTGTCCGTAGGCAAAATGAACCTCCCAATATAAGGATGGTTAACAATAATGCTCT
GACCAGGATACATCCGTTACAAAATCAAACAAATATGATCCCTCCCTTTAATGCTGTTCCCCAACGTACCATACCCCGAC
CTCAAATGTCTTCTAGATTATTTACCAGGCAACATGGCGGTATGCAAACATCGGTGAATCAGTCTCCATTGAGGTTTAGG
TTACCCAACATTAACAATCGTCAGGCCCCTGTACGTCCAAACGCAAACGCAATCATACCCCCACAGGGTGAAATTTTAGG
ATGTCGACGAAGAAGTTACCCAAGTCGATTTGAATTTGGACAATCATCATCATCTTCGGCTCAACGAAGGAGAATTGTAC
CAGCAAGCGAAAATGTTGGCTCAACTTCAATCAATCATGGAAATGCTGAACAAAGGGGCACAAATACTATATACGATCCA
AGATACGAAAGCTTCGGTTTATGTATTGATCCACACTTGAGAAAGTATGCTATGACGCTATAA