Details for Arabidopsis Locus AT1G77950

Position : Chr1 ( 5`- 29306957 .. 29311194 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77950

Protein [Map View]
MGRVKLELKRIEKSTNRQITFSKRKKGLIKKAYELSTLCDIDLALLMFSPSDRLCLFSGQTRIEDVLARYINLPDQEREN
AIVFPDQSKRQGIQNKEYLLRTLEKLKIEDDMALQINEPRPEATNSNVEELEQEVCRLQQQLQISEEELRKFEPDPMRLT
SMEEIEACEANLINTLTRVVQRREHLLRKSCEAQSNQQSMDGILLNDIVEDWGPEPEPKQAHMIANSAHHSNQPSYDLLL
RRSNSSSNQNPK*

DNA
ATGGGTCGGGTTAAATTGGAGTTAAAGCGTATAGAGAAGAGCACGAACCGACAAATTACGTTCTCAAAACGTAAAAAAGG
TTTAATAAAAAAGGCTTATGAATTGTCAACACTTTGTGACATCGATCTTGCCCTCCTCATGTTCTCTCCCTCTGATCGAC
TATGTCTCTTTTCCGGTCAAACAAGGATCGAGGACGTTTTGGCGAGGTACATCAATCTTCCTGATCAAGAAAGAGAAAAC
GCCATAGTTTTCCCTGATCAGAGCAAGCGCCAAGGTATCCAAAACAAAGAGTATTTGTTAAGGACTTTGGAAAAACTCAA
AATTGAGGATGACATGGCTCTCCAAATCAACGAACCTCGTCCAGAAGCCACCAACTCCAATGTCGAGGAACTTGAGCAAG
AAGTTTGTAGATTACAACAACAGCTTCAGATATCAGAGGAAGAACTCAGGAAATTCGAACCAGATCCAATGAGGCTAACA
TCAATGGAGGAGATTGAAGCATGTGAAGCTAACCTCATCAATACGTTGACACGTGTCGTCCAGAGAAGGGAACATTTGTT
GAGAAAGTCCTGCGAAGCACAAAGTAACCAACAAAGCATGGACGGGATCCTTCTAAATGACATCGTCGAGGATTGGGGAC
CTGAGCCCGAGCCCAAACAAGCCCATATGATAGCTAATTCGGCCCATCATTCAAATCAGCCAAGCTATGATTTACTCTTA
CGCAGGAGTAATTCGAGTTCGAACCAAAATCCAAAATGA