Details for Arabidopsis Locus AT1G77860

Position : Chr1 ( 5`- 29282643 .. 29284458 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77860

Protein [Map View]
MEVPTESKTTQIDEISHNLSFTTSNAGDSSWDKISFFRHRSRQIKRDTWLVSVFVLLQIVLFAVTMGVNDCSGNSHGHCS
AKLLGRFSFQSLSENPMLGPSASTLEHMGGLSWKALTENHEIWRILTSPWLHSGLFHLFINLGSLIFVGIYMEQQFGPLR
IAVIYFLSGIMGSLFAVLFVRNIPSISSGAAFFGLIGAMLSALAKNWNLYNSKISALAIIFTIFTVNFLIGFLPFIDNFA
NIGGFISGFLLGFVLLFKPQLRQMPPSHKGKLFEDDMNRSTRLKEQFDRPVLRIICLLVFCGILAGVLLAACWGVNLNRH
CHWCRYVDCVPTKKWSCSDMTTSCEVYSSKP*

DNA
ATGGAGGTTCCTACAGAGTCAAAGACGACGCAGATCGATGAAATCTCTCACAATCTCTCGTTTACCACTTCTAACGCCGG
CGATTCTAGCTGGGACAAGATCTCATTCTTCCGTCACCGTTCACGGCAAATCAAACGAGACACTTGGCTTGTCTCCGTCT
TCGTTCTTCTTCAGATCGTCCTCTTCGCTGTAACTATGGGCGTCAACGATTGCTCCGGGAACTCTCACGGTCACTGCTCC
GCTAAACTCCTTGGCCGATTCTCTTTCCAGTCTCTCTCCGAGAATCCTATGCTTGGTCCCTCCGCCTCAACGTTAGAGCA
TATGGGAGGTCTTTCTTGGAAAGCTCTGACGGAGAATCATGAGATTTGGCGTATTTTGACATCTCCATGGCTGCACAGTG
GATTATTTCATCTATTCATAAATCTTGGGAGTTTGATTTTCGTAGGGATATACATGGAGCAACAGTTTGGACCATTGAGG
ATTGCAGTCATATACTTCCTCTCTGGCATTATGGGTAGTCTGTTTGCTGTGTTGTTTGTTCGGAACATCCCATCAATCTC
TTCTGGTGCTGCTTTCTTTGGGTTGATTGGAGCCATGCTTTCTGCACTTGCAAAGAACTGGAATCTATATAACAGCAAGA
TTTCAGCCTTGGCGATAATATTCACTATCTTCACTGTGAATTTCCTGATAGGCTTTCTCCCTTTCATAGACAACTTTGCA
AATATTGGTGGTTTCATATCAGGATTCCTCCTTGGATTTGTGCTATTGTTCAAACCACAACTGAGACAGATGCCTCCATC
TCATAAGGGGAAATTGTTTGAAGATGATATGAACAGATCCACAAGGCTTAAAGAACAGTTTGACAGACCGGTATTAAGGA
TTATATGCCTGCTCGTGTTTTGTGGAATACTTGCCGGGGTTCTATTAGCAGCATGCTGGGGAGTCAATCTCAACCGTCAT
TGCCATTGGTGTCGCTATGTTGACTGTGTTCCAACCAAAAAATGGAGCTGCAGCGACATGACTACTTCCTGCGAGGTATA
TTCATCTAAACCATAA