Details for Arabidopsis Locus AT1G77850

Position : Chr1 ( 5`- 29272313 .. 29275419 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77850

Protein [Map View]
MSPPSATAGDINHREVDPTIWRACAGASVQIPVLHSRVYYFPQGHVEHCCPLLSTLPSSTSPVPCIITSIQLLADPVTDE
VFAHLILQPMTQQQFTPTNYSRFGRFDGDVDDNNKVTTFAKILTPSDANNGGGFSVPRFCADSVFPLLNFQIDPPVQKLY
VTDIHGAVWDFRHIYRGTPRRHLLTTGWSKFVNSKKLIAGDSVVFMRKSADEMFIGVRRTPISSSDGGSSYYGGDEYNGY
YSQSSVAKEDDGSPKKTFRRSGNGKLTAEAVTDAINRASQGLPFEVVFYPAAGWSEFVVRAEDVESSMSMYWTPGTRVKM
AMETEDSSRITWFQGIVSSTYQETGPWRGSPWKQLQITWDEPEILQNVKRVNPWQVEIAAHATQLHTPFPPAKRLKYPQP
GGGFLSGDDGEILYPQSGLSSAAAPDPSPSMFSYSTFPAGMQGARQYDFGSFNPTGFIGGNPPQLFTNNFLSPLPDLGKV
STEMMNFGSPPSDNLSPNSNTTNLSSGNDLVGNRGPLSKKVNSIQLFGKIITVEEHSESGPAESGLCEEDGSKESSDNET
QLSLSHAPPSVPKHSNSNAGSSSQG*

DNA
ATGTCACCGCCGTCGGCAACCGCCGGTGACATCAACCACCGTGAAGTAGACCCGACGATCTGGCGCGCTTGTGCTGGAGC
CTCCGTCCAGATCCCTGTCCTTCACTCTAGGGTTTACTACTTTCCACAAGGTCACGTTGAGCACTGTTGCCCTCTCCTCT
CTACTCTTCCTTCCTCCACCTCGCCGGTTCCATGTATCATCACTTCAATTCAGTTGCTCGCCGATCCGGTCACCGACGAG
GTCTTTGCTCACCTTATTCTTCAACCGATGACGCAGCAGCAGTTTACTCCGACTAATTATTCACGATTCGGCAGATTCGA
TGGCGATGTTGATGATAACAACAAGGTGACTACCTTCGCCAAAATTCTCACGCCTTCTGATGCTAACAATGGAGGTGGCT
TCTCCGTTCCTCGTTTCTGTGCTGATTCCGTCTTCCCTCTGCTTAATTTTCAAATCGATCCACCGGTTCAGAAGCTCTAC
GTCACTGATATCCATGGAGCTGTTTGGGATTTCAGGCATATCTATCGCGGTACACCGAGGCGTCACTTGCTAACAACGGG
ATGGAGTAAGTTCGTCAATAGCAAGAAGCTCATCGCTGGAGATTCGGTGGTGTTTATGAGAAAATCTGCAGATGAGATGT
TCATCGGCGTTAGGAGAACTCCGATCTCAAGCAGCGACGGAGGAAGTAGCTATTACGGAGGAGATGAGTATAACGGTTAC
TACAGTCAGAGTAGCGTTGCCAAGGAAGATGATGGGAGTCCGAAGAAGACGTTTAGGAGATCTGGGAATGGTAAGTTGAC
TGCTGAGGCTGTGACGGATGCGATCAATAGAGCGTCTCAGGGATTACCATTTGAGGTGGTGTTTTATCCGGCTGCTGGAT
GGTCTGAGTTTGTTGTGAGAGCTGAAGATGTTGAGTCTTCAATGTCTATGTATTGGACTCCTGGGACTCGAGTCAAGATG
GCTATGGAGACTGAAGATTCTTCTCGGATCACATGGTTTCAAGGCATCGTTTCCTCTACTTATCAGGAGACCGGTCCATG
GCGTGGATCTCCATGGAAGCAGCTTCAGATCACATGGGATGAACCTGAGATTCTGCAAAACGTGAAGAGGGTGAATCCAT
GGCAAGTGGAAATTGCTGCACATGCAACTCAACTGCATACCCCTTTCCCTCCAGCAAAGAGGTTGAAGTATCCACAACCC
GGAGGAGGGTTCTTGAGTGGAGATGATGGAGAAATCCTTTATCCTCAAAGTGGACTGTCTAGTGCAGCAGCACCTGATCC
AAGTCCTTCTATGTTCTCGTATTCTACATTTCCTGCTGGCATGCAGGGAGCCAGGCAATATGATTTTGGGTCTTTCAATC
CAACCGGATTCATTGGAGGAAATCCTCCCCAGCTATTCACCAATAACTTCTTAAGTCCGCTTCCTGATTTGGGAAAAGTG
TCGACTGAGATGATGAACTTTGGCAGTCCGCCATCAGATAACTTATCGCCTAATAGCAACACCACTAATCTGTCCTCTGG
AAATGACCTGGTTGGAAACCGAGGCCCCCTTTCAAAGAAAGTTAACTCGATTCAGTTGTTTGGCAAGATCATTACCGTGG
AGGAGCATTCTGAGAGCGGTCCTGCAGAGTCTGGCTTGTGTGAAGAGGATGGCAGCAAAGAGTCCAGCGACAATGAGACA
CAGTTGTCCTTATCACATGCTCCTCCAAGCGTGCCTAAACATTCCAACAGCAACGCAGGTTCTAGCTCCCAAGGTTAA