Details for Arabidopsis Locus AT1G77800

Position : Chr1 ( 5`- 29253396 .. 29260617 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77800

Protein [Map View]
MNVDQCQWRKKMMGRGVDGGCGAEEKPYRPFRRVALDKENGYEDMGSLEIDFLAQASKNLSERSPFDVPEDGSTSVLSVP
TLPIALANLLKNHSDNKKRHKKSHSGADKKKKKSSRQGDKLRSGSIWLEHEDYFRRLDFPDLETLSDLASLRSLSSRNCF
SIPSVEYDSIDIQQRETDASAKNEDVVCGDGVVLEQIKNLLTKDISEGTVRKEEDVVKPMGVDNVGNGISSGSDYSGSLE
WVLGNRNRILLTSERPSKKRKLLGSDAGLGKLMVAAPCEGNALLCDFCCTGHHQLIVCTSCKATVHKKCYGLLEDSGKPW
LCSWCELENGRADSERPCLLCPKKGGILKPVLSKTENGGPAEFAHLFCSLWMPEVYIEDLKKMEPILNFPGIKETRRKLL
CNLCKVKSGACIRCCNVVVLTLSMPDNPIVWIIFTGKCFVGIYYHNAVEAGNRLEVWGKHGCDTVELRAFCSKHSDIQES
GKSVEGGESNAAESRSPICHLPSESVGEGHLSNDEMGVDVGTPGTGSDISRNSDLQELESPHSKFNLSATDNVESGMTGR
SNEDERTLSKSLSFGLILKKLIDLGKVDVKDVAAEIGINPDALRAKLTDGDLLPDLLGKVVKWLSQHAHMGSSDKGKNLK
PKANGSVLKKEGSVSLAPDHSPEEKNSIVLDQKVHHGKSSVIPSDDHGEQSNSSSSGVMMENAFSLRPNSSQNRGNLNCP
NPIILDLFNQEAYPGFNPHRYIHKELSELGKEQTLKSSTDSDVARMTTNFDGSEEGNKHLQGAETFLQLSKARKLGILDL
SPEDELEGELLYYQLQLLGTAVSRKQLSDNLVYEVAKKLPLEIDEQHGRRWDDVLVNKYFHDVREARKQGRKEQRNKQAQ
AVLAAATAAAATSSRNTSLRKDMSEEPAQQEMSTSRRKVVGSSHLVPQTKESLLKMAVSGPPSEKRSDHHTPDFLVENPR
TCDICRRSETIWNLIVVCSSCKVAVHIDCYKCAKESTGPWYCELCAESSSEPSFNFGEKPNSSTECTLCGGTTGAFRKTT
NGQWVHAFCAEWSLESTFRRGQINPVQGMESLAKKTDNCCVCQRIYGACTKCSYGNCQTTFHPSCARSAGFHMTGGGKHP
HKAYCEKHSMEQKAKAESQKHGAEELKSLKHYRVELERLRLLCERIVKREKLKRELAISSHEILAAKRDHAARPLHVRNP
FSPPEVSSDSATTSIKGHPDSNISGSEAIQRSDDITIDSTVTDKRRGKGPLLMDTDQKTDDSATSKSRFSRKLTERQILS
GKTVPRKHCIVSPSVSEDGDNGSKPKKQHVETFAKELVMTSDEASFKNRRLPKGYFYVPVDCLQEDKPGNQKLASSDKPA
NQKTSSGDQSGKDDG*

DNA
ATGAACGTTGACCAATGCCAGTGGCGGAAGAAGATGATGGGTAGGGGAGTGGACGGAGGTTGTGGTGCTGAAGAGAAGCC
TTATCGACCATTTCGTAGGGTTGCGTTAGATAAGGAGAATGGGTATGAGGATATGGGTTCGTTGGAAATCGATTTCTTAG
CTCAAGCTAGCAAAAATCTATCTGAGAGGTCTCCTTTTGATGTTCCTGAAGATGGTTCTACTTCTGTGTTAAGTGTGCCT
ACTCTACCTATTGCTTTAGCTAATTTGCTGAAGAACCATTCGGATAATAAGAAACGGCATAAGAAGTCTCATTCTGGTGC
GGATAAGAAGAAGAAGAAGTCTTCTAGGCAAGGGGATAAGTTGAGAAGTGGGAGTATCTGGCTTGAACATGAGGACTACT
TTAGGCGCTTAGATTTTCCTGATTTAGAAACTTTGTCTGATTTAGCATCTCTACGATCTTTATCTTCTAGAAATTGCTTT
TCCATTCCATCGGTGGAATACGATTCTATTGATATTCAACAGAGGGAAACTGATGCGAGTGCAAAGAATGAGGATGTTGT
TTGTGGAGATGGCGTTGTTCTGGAACAAATTAAGAACCTTCTCACTAAAGATATATCTGAAGGCACAGTAAGAAAAGAAG
AGGATGTTGTTAAGCCAATGGGTGTTGACAATGTAGGGAATGGAATCTCCTCTGGGTCAGACTATTCTGGTAGTTTAGAA
TGGGTTTTAGGTAATAGAAATAGGATTTTGTTGACATCAGAAAGGCCCTCCAAAAAGCGGAAGCTTCTTGGTAGTGATGC
AGGTTTGGGGAAATTAATGGTTGCGGCTCCTTGTGAAGGGAATGCGTTGTTATGTGATTTTTGCTGCACTGGTCATCATC
AGTTGATTGTTTGCACTTCCTGCAAAGCTACAGTTCACAAAAAATGCTATGGCCTGCTTGAAGATTCAGGTAAACCTTGG
TTGTGCTCTTGGTGTGAGCTGGAGAATGGTCGTGCTGATTCTGAAAGACCATGCTTGCTTTGTCCAAAAAAGGGTGGCAT
CCTTAAACCTGTTCTCTCAAAAACTGAGAATGGTGGGCCGGCGGAGTTTGCTCATCTGTTTTGTTCTCTGTGGATGCCTG
AGGTGTATATAGAAGACTTGAAAAAAATGGAGCCCATCTTGAATTTTCCTGGGATAAAAGAAACTCGGAGGAAGTTATTG
TGTAACTTGTGCAAGGTGAAATCTGGTGCTTGCATTCGCTGTTGTAATGTCGTTGTCCTTACTTTGTCTATGCCAGATAA
CCCAATTGTCTGGATTATTTTCACTGGAAAATGCTTTGTTGGCATTTATTATCACAATGCAGTGGAGGCAGGGAATAGGC
TAGAGGTCTGGGGAAAACATGGGTGTGATACTGTTGAACTGCGAGCTTTCTGCTCGAAGCATTCAGATATTCAAGAAAGT
GGAAAGTCAGTAGAGGGAGGAGAAAGTAATGCAGCTGAAAGTCGTTCTCCTATATGTCATCTTCCATCAGAATCTGTTGG
AGAAGGTCACCTAAGTAATGATGAGATGGGAGTTGATGTAGGAACACCGGGTACAGGTTCTGATATTTCGAGAAACAGTG
ACTTACAAGAGCTAGAATCACCACATTCAAAATTTAACTTGTCTGCAACAGACAATGTAGAATCAGGGATGACTGGGAGA
AGCAACGAAGATGAAAGAACTCTGTCCAAGTCTCTTAGTTTTGGATTGATTCTGAAAAAGTTGATCGACCTGGGTAAAGT
GGATGTGAAGGATGTGGCTGCAGAGATTGGGATTAATCCTGATGCTTTGAGGGCTAAACTTACGGACGGAGACTTGTTAC
CTGATTTACTAGGCAAAGTAGTTAAATGGCTTAGCCAGCATGCACACATGGGTTCTTCGGATAAAGGCAAAAATTTAAAA
CCTAAAGCTAATGGATCAGTTTTGAAGAAAGAAGGAAGTGTTAGTTTGGCACCTGATCATTCTCCAGAAGAAAAGAATTC
AATAGTGCTTGATCAGAAAGTTCATCATGGGAAAAGTTCAGTTATTCCTTCTGATGATCATGGAGAACAATCAAACTCCA
GTTCTTCTGGAGTCATGATGGAGAATGCCTTTTCCTTGAGGCCAAATAGTTCTCAGAATCGTGGAAATTTGAACTGTCCA
AACCCCATTATCTTGGATCTCTTCAATCAGGAAGCATATCCTGGTTTCAATCCTCATCGTTATATCCACAAAGAATTGTC
AGAACTTGGCAAGGAACAAACCCTGAAAAGCAGCACGGATTCTGATGTGGCTAGGATGACAACCAATTTTGATGGCTCTG
AAGAAGGAAACAAACATCTGCAGGGTGCAGAGACATTTCTTCAGTTATCTAAAGCTAGGAAATTGGGCATACTGGATCTG
TCTCCTGAAGATGAATTGGAAGGAGAACTTCTATATTATCAGCTTCAGTTACTTGGCACTGCAGTTTCAAGAAAGCAACT
ATCTGACAATTTAGTCTATGAAGTTGCTAAAAAGCTGCCTCTGGAAATTGATGAACAACATGGACGAAGATGGGATGATG
TTCTGGTCAACAAATATTTCCATGATGTCAGGGAAGCAAGAAAGCAAGGTAGGAAAGAGCAAAGAAACAAACAAGCCCAG
GCTGTTCTAGCTGCTGCTACTGCTGCAGCGGCGACATCTTCTAGGAATACATCGCTTAGGAAAGATATGTCAGAAGAACC
TGCACAACAAGAGATGAGCACTTCTAGACGTAAAGTTGTTGGCAGCTCTCACCTAGTTCCACAGACAAAGGAATCACTTT
TAAAGATGGCTGTTTCTGGGCCACCATCCGAGAAGCGGTCTGATCATCACACACCAGACTTTTTAGTAGAAAATCCACGA
ACTTGTGACATCTGCAGGCGCTCCGAAACTATATGGAACCTGATTGTAGTGTGCTCTAGTTGCAAGGTTGCTGTTCACAT
TGATTGCTACAAATGTGCTAAAGAATCTACTGGTCCCTGGTACTGTGAGCTATGTGCGGAGTCATCTTCAGAACCTTCTT
TCAATTTTGGGGAAAAACCGAATTCTTCTACAGAATGTACTCTGTGTGGTGGCACAACTGGGGCTTTTAGGAAAACCACA
AATGGGCAATGGGTACATGCGTTTTGTGCTGAGTGGTCCTTGGAGTCAACGTTCAGAAGGGGACAAATAAATCCTGTGCA
GGGAATGGAGTCTCTGGCCAAGAAAACGGATAATTGTTGTGTATGCCAACGGATATATGGTGCATGCACTAAGTGCAGTT
ATGGTAACTGCCAGACGACATTCCACCCCTCCTGTGCCAGAAGCGCGGGTTTTCATATGACTGGTGGTGGTAAACATCCG
CATAAGGCGTACTGTGAGAAGCACAGCATGGAGCAGAAGGCAAAGGCCGAATCTCAGAAACATGGTGCAGAGGAGCTGAA
AAGTCTCAAACATTATAGGGTTGAACTTGAGAGGTTACGCCTTCTGTGCGAGCGGATAGTCAAGAGGGAGAAATTAAAGC
GAGAGTTGGCTATTTCCTCACATGAAATACTTGCTGCCAAAAGGGATCATGCTGCACGGCCATTACATGTCCGTAATCCA
TTTTCTCCTCCAGAAGTTTCGTCGGACTCAGCTACAACATCAATAAAAGGCCATCCTGATAGTAATATATCTGGCAGTGA
AGCAATACAGAGGTCAGATGATATCACTATTGACAGCACAGTCACTGATAAGCGCAGAGGCAAAGGTCCCTTATTAATGG
ACACGGATCAGAAAACTGATGACAGTGCTACTTCCAAGAGTCGGTTTTCCCGTAAACTAACAGAAAGACAGATCTTATCT
GGGAAAACTGTTCCCCGCAAACATTGTATAGTGTCACCTAGTGTTTCAGAGGATGGAGATAACGGGTCAAAGCCCAAGAA
GCAGCATGTAGAAACATTTGCAAAAGAGCTGGTGATGACATCAGATGAAGCTTCTTTCAAGAACCGGCGGCTCCCAAAGG
GATACTTCTATGTTCCTGTTGATTGTCTTCAGGAAGACAAACCGGGAAACCAGAAGCTGGCTTCATCTGACAAGCCAGCG
AACCAGAAGACATCTTCAGGTGATCAGTCAGGTAAAGACGACGGGTAA