Details for Arabidopsis Locus AT1G77765

Position : Chr1 ( 5`- 29245050 .. 29246281 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77765

Protein [Map View]
MQMGYENPRTMYGVIITVYVDRQTTTVRSFQGRQKNDEGERFIERTWKRGIGKIRGYDRRANLLAYIRQKRAESLTGDSK
CDVVESDNKPERLSPSPKKKKRRWIRRMMSKFRLPFLRPFRRKNRTWRYRHFDPDEEEGDARSKAKHNSDIWVLHLFLSV
FLIYTFLTKDCSMFF*

DNA
ATGCAAATGGGATATGAAAATCCAAGGACTATGTACGGTGTGATCATCACCGTGTACGTTGATCGTCAAACGACGACCGT
CCGATCATTTCAAGGGAGACAGAAGAATGATGAAGGGGAGAGATTCATTGAACGGACGTGGAAGCGTGGGATCGGAAAGA
TACGCGGTTATGATCGGAGAGCGAATCTGTTAGCTTATATTCGTCAGAAGAGGGCCGAGAGTCTCACCGGAGATTCGAAA
TGCGACGTCGTAGAGAGTGACAACAAGCCTGAACGGCTGAGTCCGAGTCCGAAGAAGAAGAAAAGAAGGTGGATAAGAAG
AATGATGAGTAAGTTCCGGTTACCGTTTCTTCGGCCATTTCGCCGGAAAAATAGAACGTGGAGATACAGACATTTTGATC
CAGATGAAGAAGAAGGAGATGCAAGGAGCAAAGCTAAACACAACTCAGATATTTGGGTACTTCATCTTTTTCTTTCTGTT
TTTCTAATTTATACTTTTCTTACTAAAGATTGTTCTATGTTTTTCTGA