Details for Arabidopsis Locus AT1G77760

Position : Chr1 ( 5`- 29235803 .. 29239445 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77760

Protein [Map View]
MATSVDNRHYPTMNGVAHAFKPPLVPSPRSFDRHRHQNQTLDVILTETKIVKETEVITTVVDSYDDSSSDDEDESHNRNV
PYYKELVKKSNSDLEPSILDPRDESTADSWIQRNSSMLRLTGKHPFNAEAPLPRLMHHGFITPVPLHYVRNHGAVPKANW
SDWSIEITGLVKRPAKFTMEELISEFPSREFPVTLVCAGNRRKEQNMVKQTIGFNWGSAGVSTSLWKGIPLSEILRRCGI
YSRRGGALNVCFEGAEDLPGGGGSKYGTSIKKEMAMDPARDIILAYMQNGELLTPDHGFPVRVIVPGFIGGRMVKWLKRI
IVTPQESDSYYHYKDNRVLPSLVDAELANSEAWWYKPEYIINELNINSVITTPGHAEILPINAFTTQKPYTLKGYAYSGG
GKKVTRVEVTLDGGDTWSVCELDHQEKPNKYGKFWCWCFWSLDVEVLDLLSAKDVAVRAWDESFNTQPDKLIWNLMGMMN
NCWFRIRTNVCKPHRGEIGIVFEHPTRPGNQSGGWMAKERQLEISSESNNTLKKSVSSPFMNTASKMYSISEVRKHNTAD
SAWIIVHGHIYDCTRFLKDHPGGTDSILINAGTDCTEEFEAIHSDKAKKLLEDYRIGELITTGYDSSPNVSVHGASNFGP
LLAPIKELTPQKNIALVNPREKIPVRLIEKTSISHDVRKFRFALPSEDQQLGLPVGKHVFVCANINDKLCLRAYTPTSAI
DAVGHIDLVVKVYFKDVHPRFPNGGLMSQHLDSLPIGSMIDIKGPLGHIEYKGKGNFLVSGKPKFAKKLAMLAGGTGITP
IYQIIQSILSDPEDETEMYVVYANRTEDDILVREELEGWASKHKERLKIWYVVEIAKEGWSYSTGFITEAVLREHIPEGL
EGESLALACGPPPMIQFALQPNLEKMGYNVKEDLLIF*

DNA
ATGGCGACCTCCGTCGATAACCGCCATTATCCCACCATGAACGGCGTCGCTCACGCCTTCAAACCTCCTCTCGTTCCTTC
TCCTCGCTCATTCGACCGCCACCGTCACCAAAACCAAACTCTCGACGTCATCCTCACCGAAACTAAAATCGTCAAAGAAA
CCGAAGTCATCACCACCGTCGTAGACAGTTACGACGACTCCTCAAGCGACGACGAAGACGAGAGCCATAACCGTAACGTC
CCTTACTACAAAGAGCTGGTTAAAAAATCAAACAGCGATTTAGAACCGTCGATTTTAGATCCGAGAGATGAATCAACGGC
TGATAGTTGGATTCAACGTAACTCATCCATGCTCCGTCTCACCGGAAAACATCCATTCAACGCCGAAGCACCTCTTCCTC
GTCTTATGCACCATGGATTCATCACTCCAGTTCCACTCCATTACGTCCGCAACCACGGTGCAGTTCCCAAAGCGAATTGG
TCAGACTGGTCAATCGAAATTACCGGACTCGTTAAACGTCCGGCTAAATTCACCATGGAAGAGCTAATCTCCGAGTTCCC
CAGCCGCGAATTCCCGGTGACACTCGTCTGCGCCGGTAATCGCCGCAAGGAACAGAACATGGTGAAACAAACGATCGGAT
TCAATTGGGGATCCGCCGGAGTATCTACTTCTCTATGGAAAGGTATTCCGTTAAGCGAAATCCTCCGTCGATGCGGGATC
TATAGCCGGAGAGGAGGCGCGTTAAACGTTTGCTTCGAAGGAGCGGAGGATCTTCCCGGCGGCGGCGGATCTAAATACGG
AACAAGTATTAAGAAGGAGATGGCGATGGATCCGGCTAGAGATATTATCTTAGCTTATATGCAAAACGGCGAGCTTTTAA
CGCCGGATCATGGGTTTCCGGTTCGGGTCATTGTACCGGGTTTCATCGGTGGTCGGATGGTTAAATGGTTAAAGAGAATC
ATCGTCACGCCTCAAGAATCTGACAGTTACTATCACTATAAAGACAATCGAGTCCTTCCTTCTCTCGTTGATGCTGAGCT
GGCAAATTCCGAAGCTTGGTGGTATAAGCCTGAATACATAATCAACGAGCTTAATATAAACTCGGTGATTACAACACCTG
GTCACGCAGAGATTTTACCGATTAATGCATTCACTACTCAGAAGCCGTACACATTAAAAGGCTACGCTTATTCTGGAGGA
GGTAAGAAGGTAACGAGGGTTGAGGTGACTCTAGACGGAGGAGACACGTGGAGTGTTTGTGAGCTTGACCACCAGGAGAA
ACCGAACAAGTACGGTAAATTCTGGTGCTGGTGTTTCTGGTCACTTGACGTTGAGGTTCTTGATCTGCTCAGTGCTAAAG
ACGTCGCGGTTCGAGCCTGGGACGAGTCTTTCAATACTCAGCCTGATAAACTCATCTGGAACCTCATGGGGATGATGAAC
AATTGCTGGTTCAGGATTAGGACCAACGTGTGCAAGCCTCATAGAGGAGAGATAGGGATAGTTTTCGAACACCCGACCAG
ACCCGGAAACCAGTCGGGTGGGTGGATGGCAAAGGAGCGTCAGCTTGAGATTTCCTCAGAATCCAACAATACCTTGAAGA
AATCTGTCTCATCTCCTTTCATGAACACTGCCTCGAAGATGTATTCAATCTCTGAAGTTAGAAAACACAACACTGCTGAC
TCTGCATGGATCATCGTCCACGGTCACATCTATGACTGTACACGTTTCTTGAAAGATCATCCAGGAGGCACAGATTCTAT
CCTGATAAACGCAGGTACAGATTGCACCGAAGAGTTTGAAGCCATTCACTCTGACAAAGCCAAGAAGCTTTTGGAAGATT
ACCGTATCGGTGAACTCATCACCACTGGCTACGACTCTTCCCCTAACGTCTCAGTTCATGGTGCCTCAAACTTTGGTCCT
TTGTTAGCTCCAATCAAAGAGCTAACTCCTCAAAAGAACATTGCTTTGGTCAACCCACGTGAGAAAATCCCGGTTAGGCT
CATTGAGAAGACTTCGATCTCGCACGACGTTCGTAAGTTCCGATTCGCATTACCATCAGAAGATCAACAGCTTGGTTTAC
CCGTGGGGAAGCACGTTTTCGTTTGCGCCAACATAAACGACAAACTCTGTCTCAGAGCTTATACTCCCACCAGCGCCATC
GACGCGGTTGGTCATATCGACCTCGTCGTCAAAGTTTACTTCAAAGACGTTCATCCAAGGTTTCCCAATGGTGGACTCAT
GTCTCAACACTTAGACTCGTTACCAATCGGGTCAATGATAGATATCAAAGGTCCACTAGGGCACATCGAGTACAAAGGCA
AAGGCAACTTCCTGGTCAGCGGCAAACCTAAGTTTGCCAAGAAACTAGCAATGCTCGCCGGAGGAACAGGCATCACTCCT
ATCTACCAGATCATTCAATCTATATTGAGTGATCCAGAGGACGAAACCGAGATGTATGTGGTTTACGCAAACAGAACCGA
GGATGACATTCTTGTGAGGGAAGAGCTAGAAGGATGGGCTAGTAAGCATAAGGAGAGGCTAAAGATTTGGTACGTCGTTG
AAATCGCAAAGGAAGGTTGGAGTTACAGTACCGGGTTTATAACTGAAGCTGTGCTTAGGGAACATATCCCTGAAGGTTTG
GAAGGCGAATCGCTAGCACTCGCATGCGGACCACCGCCTATGATTCAGTTTGCGTTGCAGCCAAATCTAGAGAAGATGGG
TTACAACGTGAAGGAGGATCTCTTAATCTTCTAG