Details for Arabidopsis Locus AT1G77640

Position : Chr1 ( 5`- 29178737 .. 29179675 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77640

Protein [Map View]
MVKQELKIQVTTSSSSLSHSSSSSSSSTSALRHQSCKNKIKKYKGVRMRSWGSWVTEIRAPNQKTRIWLGSYSTAEAAAR
AYDAALLCLKGPKANLNFPNITTTSPFLMNIDEKTLLSPKSIQKVAAQAANSSSDHFTPPSDENDHDHDDGLDHHPSASS
SAASSPPDDDHHNDDDGDLVSLMESFVDYNEHVSLMDPSLYEFGHNEIFFTNGDPFDYSPQLHSSEATMDDFYDDVDIPL
WSFS*

DNA
ATGGTGAAACAAGAACTCAAGATCCAAGTTACTACTTCCTCATCATCACTCTCTCATTCTTCATCTTCTTCTTCTTCTTC
AACGTCGGCACTACGTCATCAATCTTGTAAGAACAAGATAAAGAAGTATAAAGGTGTGAGGATGCGAAGTTGGGGATCAT
GGGTTACTGAAATTAGGGCACCAAATCAAAAGACAAGAATCTGGTTAGGTTCTTACTCCACCGCAGAAGCAGCTGCTAGG
GCTTACGACGCTGCTCTCTTGTGTCTTAAGGGACCTAAAGCTAATCTCAACTTCCCTAACATCACCACTACTTCTCCTTT
TCTTATGAACATCGACGAAAAGACCCTTTTGTCCCCAAAATCAATCCAAAAGGTCGCCGCTCAAGCCGCTAACTCCTCTT
CTGACCATTTTACCCCTCCGTCCGATGAAAATGATCATGATCATGATGACGGACTCGATCACCATCCATCTGCTTCTTCT
TCAGCTGCATCTTCACCACCAGATGATGATCATCATAATGATGACGATGGTGATTTGGTATCGTTGATGGAATCTTTCGT
GGATTACAACGAACACGTGTCTCTGATGGATCCATCGCTGTATGAATTTGGACATAATGAGATCTTCTTCACCAACGGAG
ATCCGTTTGATTATTCTCCACAGTTACATAGCTCAGAGGCAACGATGGATGACTTCTACGACGATGTTGATATTCCGCTA
TGGAGTTTCAGTTAA