Details for Arabidopsis Locus AT1G77620

Position : Chr1 ( 5`- 29167764 .. 29172867 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77620

Protein [Map View]
MDQTPRRNVRRKLVQSSLLPHKPEDVIDSNGDPMCDEGGEVGDGRSQGKKTRKQKERTPKNGATKKVAKGKSPRKTTPKK
CATKNGIVAAGDQMIAANVSPPVPNLRLEAKLRAEENSRMSAGKQIHPFFSTWKGGKRNQEAVAAENGTCLGRGRDKIVT
IGPIHVFDKFQDDYPTTLDWKNWTFYEQTSTTESPDQQIKFNSLEPRPKEFDLNELPSLSHPDVCVIDDEEPEQCTSQSE
GIAEASSVVLIEDQEEKRGCLGFLDGAESDCEVHEAINLSDDAGGEANISHEMQHLSCRESNDSSGQPCNRLWVDKYQPR
SASEVCGNTESVKVMNEWLRQWYERGFQPNKDFLSSDEDKSQDADYNCSESDSDSEKSGAEDSQKNVLLIVGPAGSGKSA
AIHACAKEQGFKILESNTSECRSGTVVRQKFGEALKSYSLSRSLDPLFNSCTDGNGVEDVVEVMPVLHIQNDGANLKPLI
LFEDVDICFAEDRGLVSAIQQIAVKAKGPVVLTANDKNHGLPDNLERIEIYFSLPSKEELFNHLSLVCAAEEVKVNHGSL
EEMTTFCGGDIRKAIMQLQFWFQSKPKRARKVKNTGNQDLFDHEAGHLLLPKIIARDFPSQLSQLVENEIAKVLSMEEER
NNTVEVFVEEVENEKMLNRLWRRGTGKNSIQAKKAAMFRQNTTFEDYDELEDVLRIPCELSNTSYQPLSFSQPNRRRKLN
VVMSSDSEDEPLTDIRVSISQHQKDDRLIFQEDGTLSSYWPDMQKETNPLADPSRAEILEAACYQYETSKFSYINEVSQS
VEISCVPESSYVPETLMDGEAELSPRAVSCGHFDGRVEVSMNEDVVQTPPSKEIYIDRFQIFDCLKNTSEIIAESSDATV
MEDCFKEYVGAAQKMQQVSDECSRMDFGKTYKTAEKPKLDTSRSAVQESWEKICSNLADFKPYLDSEPVEAPQVLDLTHQ
ITNLISEADLTHSRCLNLGALEPMMNTSGDLDTSGLSQMLEEMTSTVSQQEFCFLTNQITTTGSVPTSSATMVPERGLTV
DEARQDYTSSNGSCLDMKPDILEDLLKCRRMTRLSGVLESVVPLRSLKGRAFHEYASFIGQISRADPSNLSGALEKGRRR
RPREARHYLSMELSSEDIALLGQHSTYNRNE*

DNA
ATGGATCAGACTCCACGGCGGAATGTTCGTCGGAAATTGGTTCAGTCGTCTTTGCTCCCCCATAAACCGGAGGATGTAAT
TGACTCTAATGGAGATCCGATGTGCGATGAAGGAGGAGAAGTAGGAGATGGTCGTAGTCAAGGGAAGAAGACGAGAAAAC
AGAAAGAGAGAACTCCGAAGAACGGAGCTACCAAGAAGGTGGCTAAAGGAAAGAGTCCTCGAAAAACAACTCCTAAGAAA
TGTGCAACTAAAAACGGAATTGTAGCTGCTGGTGATCAGATGATTGCTGCCAATGTTTCACCTCCAGTTCCCAATTTGCG
CCTGGAAGCTAAGTTAAGAGCTGAGGAAAATTCGCGGATGTCTGCTGGGAAGCAAATACATCCGTTTTTCTCGACTTGGA
AAGGAGGTAAAAGAAATCAAGAAGCTGTTGCAGCAGAGAATGGTACGTGTCTTGGTCGAGGGAGAGATAAAATCGTCACC
ATTGGCCCTATCCATGTATTTGACAAGTTTCAGGATGATTATCCAACCACCCTTGATTGGAAGAACTGGACTTTCTATGA
GCAAACATCTACTACTGAGAGTCCTGATCAACAAATAAAATTTAACTCTCTTGAACCTCGGCCCAAGGAGTTTGATTTAA
ATGAATTGCCATCTCTTTCACATCCTGACGTGTGTGTCATCGATGATGAGGAGCCTGAACAATGCACTAGTCAATCAGAA
GGTATTGCAGAGGCATCTTCGGTAGTCTTAATAGAAGACCAGGAGGAGAAACGTGGGTGCCTCGGCTTCTTAGATGGAGC
AGAATCGGATTGTGAAGTTCATGAAGCAATTAACTTGTCTGATGATGCTGGTGGTGAAGCCAATATTTCTCATGAAATGC
AACACCTGTCATGTCGAGAAAGTAATGACTCCAGTGGCCAACCTTGTAATCGATTATGGGTAGATAAGTACCAGCCAAGA
AGTGCCTCGGAGGTATGTGGTAATACTGAATCTGTAAAGGTAATGAATGAATGGCTGCGCCAATGGTATGAGAGAGGGTT
TCAGCCAAACAAAGACTTTTTGAGTAGTGATGAAGATAAATCGCAAGATGCTGATTACAACTGTTCTGAAAGTGACTCTG
ACTCAGAAAAAAGTGGTGCTGAAGATAGCCAGAAGAATGTTCTCTTAATTGTTGGTCCAGCTGGGAGTGGGAAATCTGCA
GCCATTCATGCATGCGCCAAGGAACAAGGATTTAAAATCCTAGAGTCCAATACATCAGAATGCCGAAGTGGAACAGTAGT
TAGGCAGAAATTTGGGGAGGCTCTCAAGTCATATAGCCTGTCAAGGTCCTTGGACCCTCTTTTCAATTCCTGTACTGATG
GCAATGGGGTAGAGGATGTAGTTGAAGTGATGCCCGTATTACATATCCAGAATGATGGAGCTAACTTGAAGCCTTTAATT
CTTTTCGAAGATGTAGATATTTGCTTTGCTGAAGATCGTGGTCTCGTTTCTGCTATCCAGCAGATTGCTGTGAAAGCAAA
AGGGCCTGTGGTATTGACTGCCAATGACAAGAATCATGGGTTACCAGACAACTTAGAGAGGATAGAAATATACTTTTCAT
TGCCATCAAAAGAAGAACTGTTTAACCACCTTTCTCTGGTTTGTGCAGCAGAGGAAGTTAAAGTTAATCATGGTTCACTA
GAGGAAATGACCACGTTTTGTGGTGGAGATATACGGAAAGCAATTATGCAATTGCAGTTTTGGTTTCAGAGTAAACCGAA
AAGAGCCAGAAAGGTGAAGAATACAGGTAATCAAGATCTCTTTGATCATGAAGCTGGCCACTTGCTGCTTCCCAAGATAA
TTGCACGGGATTTCCCTTCTCAATTATCTCAGTTGGTGGAGAATGAGATTGCTAAGGTATTATCTATGGAAGAGGAAAGA
AATAACACAGTGGAAGTATTTGTTGAAGAGGTTGAAAACGAAAAAATGCTTAATAGATTATGGAGGCGTGGCACAGGAAA
GAACAGTATACAAGCCAAGAAAGCAGCGATGTTCAGGCAGAACACTACTTTTGAAGATTATGACGAATTAGAAGACGTCT
TAAGGATTCCGTGTGAACTTAGCAACACTTCCTACCAACCACTCTCTTTCTCTCAGCCAAACAGAAGGCGGAAGCTCAAT
GTTGTGATGTCCTCTGATTCAGAAGATGAGCCTCTGACTGACATACGGGTTTCCATTTCTCAACATCAGAAGGACGACAG
ATTGATTTTCCAAGAAGATGGTACGTTGTCCTCATATTGGCCAGATATGCAAAAGGAAACAAACCCATTAGCTGATCCTT
CTAGAGCAGAAATATTGGAGGCAGCTTGTTATCAGTATGAGACATCAAAATTCTCTTACATTAATGAGGTGTCCCAGTCA
GTTGAAATATCATGTGTACCAGAGTCTTCATATGTTCCAGAAACTTTAATGGATGGTGAAGCTGAGCTGTCGCCAAGAGC
AGTATCTTGCGGACATTTTGATGGAAGAGTAGAGGTTTCAATGAATGAGGACGTTGTACAGACTCCCCCATCAAAAGAGA
TATACATAGACAGATTCCAGATTTTTGATTGTTTAAAGAATACAAGTGAGATCATTGCAGAATCTTCTGATGCGACAGTG
ATGGAAGACTGTTTCAAGGAATATGTAGGGGCTGCCCAGAAGATGCAACAAGTTTCAGATGAATGTAGCCGTATGGATTT
TGGTAAGACATACAAGACGGCTGAGAAACCAAAGCTAGATACCTCTAGATCTGCGGTGCAAGAATCATGGGAAAAAATCT
GTTCCAATCTTGCTGATTTCAAGCCATACTTGGATTCAGAACCTGTAGAAGCTCCACAAGTTCTTGATCTCACTCATCAG
ATAACCAATCTAATTTCAGAAGCTGACCTAACACATTCCAGATGCCTGAACCTTGGAGCTTTGGAGCCAATGATGAACAC
TTCAGGAGATCTTGATACGTCTGGTTTATCTCAGATGCTTGAAGAGATGACTTCCACCGTGTCACAGCAAGAATTTTGCT
TTTTGACAAACCAAATTACGACAACGGGATCCGTTCCTACTTCATCAGCCACCATGGTACCAGAAAGAGGATTAACAGTA
GACGAGGCAAGGCAGGATTACACATCGAGCAATGGAAGCTGCTTGGATATGAAACCAGATATACTTGAAGACTTACTAAA
ATGTAGGCGAATGACACGGCTTTCCGGTGTCTTAGAGTCAGTAGTCCCTCTGAGATCATTGAAAGGAAGAGCTTTCCATG
AATATGCTTCATTCATAGGGCAGATTTCAAGAGCAGATCCCTCTAACTTATCCGGAGCCTTGGAGAAAGGCAGACGGCGA
AGGCCAAGAGAAGCTCGACATTACCTGTCAATGGAACTATCCTCCGAAGATATTGCATTATTGGGCCAACACAGCACATA
CAATAGAAATGAATAA