Details for Arabidopsis Locus AT1G77610

Position : Chr1 ( 5`- 29165210 .. 29167773 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77610

Protein [Map View]
MEEGSMFRSLLAILQWWGFNVTVIIMNKWIFQKLDFKFPLSVSCVHFICSSIGAYIVIKVLKLKPLIVVDPEDRWRRIFP
MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAA
LFGCLATSTKTILAESLLHGYKFDSINTVYYMAPFATMILGIPALLLEGSGILSWFEAHPAPWSALIIILSSGVLAFCLN
FSIFYVIHSTTAVTFNVAGNLKVAVAVMVSWLIFRNPISYMNAVGCGITLVGCTFYGYVRHMLSQQTPGTPRTPRTPRSK
MELLPLVNNDKLEGKV*

DNA
ATGGAGGAAGGAAGTATGTTCAGATCTCTATTAGCGATTCTTCAGTGGTGGGGTTTCAATGTTACCGTCATCATCATGAA
CAAATGGATCTTTCAGAAACTGGATTTTAAGTTTCCACTATCGGTTTCATGTGTTCACTTCATATGTTCGTCGATTGGAG
CTTACATCGTTATCAAAGTTCTCAAGCTTAAACCATTGATTGTTGTCGATCCTGAAGATCGATGGAGGAGGATTTTTCCA
ATGTCTTTCGTGTTTTGTATCAACATTGTCTTGGGAAATGTCAGTCTTCGTTACATTCCGGTTTCGTTTATGCAGACGAT
TAAGTCTTTCACTCCAGCTACTACAGTTGTGTTACAGTGGCTGGTATGGAGGAAATACTTTGACTGGCGTATTTGGGCGT
CTCTCGTGCCTATTGTTGGTGGAATTCTTCTGACATCTGTGACTGAACTTAGTTTTAACATGTTTGGATTCTGTGCTGCC
CTGTTTGGATGTTTAGCTACTTCCACAAAGACCATTCTAGCCGAATCTCTTCTTCATGGTTACAAATTTGACAGCATAAA
CACCGTTTACTATATGGCGCCTTTTGCCACCATGATTCTCGGGATACCAGCGTTATTACTGGAAGGCAGTGGAATTTTGA
GCTGGTTTGAAGCACACCCTGCTCCCTGGTCAGCCCTCATCATTATACTCAGTTCTGGTGTTCTAGCCTTCTGTCTCAAC
TTCTCCATCTTCTATGTCATTCACTCCACAACTGCAGTCACATTCAACGTGGCTGGAAACCTTAAGGTTGCAGTGGCTGT
AATGGTCTCATGGTTGATATTCCGTAACCCAATATCATATATGAATGCTGTTGGATGCGGAATTACGCTTGTGGGCTGCA
CGTTTTATGGATATGTGAGGCATATGCTTTCACAGCAAACACCGGGAACTCCTAGGACTCCTCGTACCCCAAGAAGCAAG
ATGGAATTACTTCCACTTGTTAATAATGATAAACTCGAAGGCAAAGTCTGA