Details for Arabidopsis Locus AT1G77510

Position : Chr1 ( 5`- 29126650 .. 29129612 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77510

Protein [Map View]
MAFKGFACFSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEYEKAASELSSHNP
PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSGPASVEIKSADSATEVVGEKN
VVAVGVFPKLSGDEFDSFMALAEKLRADYDFAHTLDAKFLPRGESVEGPAVRLFKPFDELFVDSKDFNGEALEKFVKESS
IPLVTVFDSDPNNHPYVAKFFESPATKAMMFVNFTGATAEALKSKYREVATSNKDQSLAFLVGDAESSQGAFQYFGLEES
QVPLIIIQTPDNKKYLKVNVEVDQIESWFKDFQDGKVAVHKKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAP
WCGHCQKLAPILDEVALSFQNDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSE
KKPTSHGEESTKSEEPKKTEETAAKDEL*

DNA
ATGGCGTTTAAGGGTTTCGCGTGTTTTTCGATTCTTTTGTTGTTGTCTCTATTCGTTTCCTCTATACGAAGCGAGGAGAC
GAAGGAATTTGTCTTGACTCTCGATCACTCTAACTTCACCGAAACCATCTCCAAGCACGATTTCATCGTCGTCGAGTTCT
ACGCCCCTTGGTGTGGTCACTGCCAGAAGCTTGCTCCTGAGTACGAGAAGGCTGCATCAGAGTTGAGTAGTCATAACCCT
CCTCTTGCTCTCGCCAAGATCGATGCTAGTGAAGAAGCAAACAAAGAATTTGCTAATGAGTACAAGATTCAGGGTTTCCC
CACTCTTAAGATTTTGAGAAATGGAGGGAAGTCGGTTCAAGATTACAACGGACCTCGTGAAGCTGAGGGTATTGTCACTT
ATTTGAAGAAGCAAAGTGGTCCTGCTTCTGTTGAAATTAAGTCAGCTGATTCTGCCACTGAGGTTGTTGGTGAAAAGAAT
GTTGTTGCTGTTGGAGTGTTCCCTAAATTATCCGGGGATGAGTTTGATTCTTTCATGGCCCTTGCTGAGAAATTGCGTGC
TGACTATGATTTCGCACACACTTTGGATGCTAAGTTTCTTCCTCGTGGAGAGTCTGTGGAAGGACCTGCAGTGAGGCTGT
TCAAGCCTTTTGATGAATTGTTTGTTGACTCCAAGGACTTCAATGGGGAAGCTCTAGAGAAATTTGTCAAAGAATCAAGT
ATCCCACTTGTCACCGTCTTTGACAGTGATCCAAACAACCACCCTTATGTTGCCAAATTCTTTGAAAGCCCTGCCACTAA
GGCGATGATGTTCGTTAACTTCACTGGAGCAACAGCTGAAGCTCTAAAATCAAAGTACCGTGAAGTAGCTACATCCAACA
AAGATCAAAGTCTTGCCTTCCTTGTTGGTGATGCAGAGAGCAGCCAAGGCGCTTTCCAGTACTTTGGACTCGAAGAGAGC
CAAGTTCCCCTCATCATCATCCAGACCCCAGATAACAAGAAGTATTTGAAAGTCAACGTTGAGGTTGACCAGATTGAATC
ATGGTTCAAGGACTTCCAGGACGGAAAAGTTGCTGTCCACAAAAAATCCCAACCTATTCCAGCTGAGAACAACGAACCTG
TGAAGGTTGTTGTTGCCGAGAGCCTTGACGACATAGTTTTCAAGTCTGGAAAGAATGTCTTGATTGAGTTCTATGCACCA
TGGTGTGGACATTGTCAAAAACTTGCTCCAATCTTGGACGAAGTGGCTTTGTCATTCCAGAACGACCCAAGTGTGATCAT
AGCAAAATTGGACGCAACCGCAAATGATATCCCAAGTGATACCTTCGATGTGAAAGGATTCCCGACCATTTACTTCAGGT
CAGCGAGCGGAAATGTTGTAGTGTACGAAGGAGACAGGACAAAGGAAGACTTCATAAACTTCGTTGAGAAGAACAGTGAG
AAGAAGCCAACTTCTCATGGAGAAGAGTCTACCAAGAGTGAGGAACCTAAGAAGACCGAGGAAACGGCCGCAAAGGACGA
GCTGTAG