Details for Arabidopsis Locus AT1G77330

Position : Chr1 ( 5`- 29062990 .. 29064537 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77330

Protein [Map View]
MAIPVIDFSKLNGEEREKTLSEIARACEEWGFFQLVNHGIPLELLNKVKKLSSDCYKTEREEAFKTSNPVKLLNELVQKN
SGEKLENVDWEDVFTLLDHNQNEWPSNIKETMGEYREEVRKLASKMMEVMDENLGLPKGYIKKAFNEGMEDGEETAFFGT
KVSHYPPCPHPELVNGLRAHTDAGGVVLLFQDDEYDGLQVLKDGEWIDVQPLPNAIVINTGDQIEVLSNGRYKSAWHRVL
AREEGNRRSIASFYNPSYKAAIGPAAVAEEEGSEKKYPKFVFGDYMDVYANQKFMPKEPRFLAVKSL*

DNA
ATGGCGATTCCTGTTATCGATTTCTCCAAACTCAATGGTGAAGAAAGAGAGAAGACACTGTCTGAAATCGCTAGAGCTTG
CGAAGAGTGGGGATTTTTTCAGCTGGTGAACCATGGTATTCCATTGGAGCTTCTAAATAAGGTGAAGAAGCTGAGCTCAG
ATTGCTACAAAACAGAGAGAGAAGAAGCATTCAAGACTTCTAATCCCGTGAAGTTGCTCAACGAATTGGTTCAAAAGAAC
TCTGGCGAGAAGCTAGAAAACGTGGACTGGGAAGATGTCTTCACTCTCTTGGACCATAACCAAAACGAATGGCCATCCAA
CATTAAAGAGACTATGGGAGAATACAGAGAAGAAGTGAGGAAGCTAGCGAGCAAGATGATGGAAGTGATGGATGAGAATT
TGGGTTTGCCTAAAGGTTACATAAAGAAAGCTTTCAATGAAGGAATGGAAGATGGAGAAGAGACAGCTTTCTTTGGGACT
AAAGTCAGCCATTACCCTCCTTGTCCTCATCCTGAGCTAGTCAATGGCCTTCGAGCTCATACTGATGCAGGAGGTGTCGT
TTTGCTTTTCCAAGACGATGAATATGATGGCCTTCAGGTCTTGAAAGACGGCGAGTGGATCGATGTTCAGCCTCTACCTA
ATGCCATTGTTATCAACACTGGTGATCAGATTGAAGTTCTTAGCAACGGAAGGTACAAGAGTGCGTGGCACAGGGTGTTG
GCGAGGGAGGAAGGAAACAGAAGGTCTATAGCTTCCTTCTACAATCCGTCGTACAAGGCGGCGATAGGGCCAGCCGCGGT
GGCGGAAGAGGAAGGAAGTGAGAAGAAGTATCCAAAGTTTGTGTTTGGAGATTACATGGATGTTTATGCAAACCAGAAGT
TCATGCCTAAAGAGCCTCGTTTTCTAGCTGTAAAGTCTCTCTAA