Details for Arabidopsis Locus AT1G77320

Position : Chr1 ( 5`- 29056532 .. 29062966 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77320

Protein [Map View]
MKTTQLFKGANVFMSRNLVPPEVFDTLLDAFKLNGAEIFLCCDPSRSGPSDFHVIASPDHEKFKDLKAKGCNLIGPQCAL
FCAKEGRPLPQRGFTCCLAMDGLKVLASGFLVDEKVKIKELVTSMGGVLLSRASSDVNFVIVKNVLAAKYKWALNKKPIV
TLNWLHRCWNEHRVVPQEPYKIPPFSGLTICVTRIPADERKGMEKVISEYGGSYSAELTKSCTHLIADAAEGDKYKVARK
WGHIQIVTRKWFQQSIDKKVCLNEESYPVLGSIPLTRGVRDLGVHNGLEKFPSAATASAADSYVSCAQSRDSDIEASASQ
NVFPTSMNPSTDVKEPGGGPTARPQEQNIDGCTARDSESEDNDLYLSDCRIFLLGFEASEMRKLAKLVRRGGGSRYMLLN
ERMTHIVVGTPSESEKREARSVAASGVIQVVIPSWLEDCDREKKEIPVHNIYTANHLILPRDSACLTKGSFARMSSMEQT
KNTHDQTMVYDSSSRSINVSNGPATLLGKNKEAMQEFGRKDEIHTGRKIVSPTQKETLISLVTCESKEQRSIQCEFSGQN
DQERKSSVFKGETFCFSHSFPEDRRPQIVEWVNQGGGEVVNDPLINNAHFTIECHGGFQSTETTQTIYVSSHWVRNCLKV
GCLLAVSSHILYSPLPCQTPLPGFESLCICSSQHNEKNVELLRNLSVVLGADFVERLTRKVTHLICNFAKGDKYVRASKW
GIISVTPDWLYECVRQNQVVCTDNFHPRELTTQDREAGSQFHTQFVPMASRDSMSLPVSHSEDREKIQSFAGKSGCGKGE
VYNRLGEIGKEQTFPSKKAKLLRDGQESDVFPVRELPSNCDRPSHSGDGIVTGYDVASGREVPDVADTIEDLLEQTSKIQ
DQKSPGRILEKTHFSTSEQYNTGNHSVTGLSRHWINRVHKNDDMGSPPGDATTDTYGNFSETQTESQVVGYEEDLSGRQM
LIDRVRTRSSLT*

DNA
ATGAAGACGACGCAACTGTTCAAAGGGGCAAATGTTTTTATGTCTCGGAATCTGGTGCCTCCTGAAGTCTTCGACACACT
TCTCGATGCTTTCAAGCTTAACGGTGCCGAAATCTTCCTCTGCTGCGACCCATCTCGGAGTGGTCCCTCTGATTTCCATG
TCATCGCTTCTCCCGATCATGAGAAATTTAAGGATCTTAAAGCCAAGGGTTGTAACTTAATAGGTCCGCAATGTGCGCTC
TTCTGTGCAAAAGAGGGTAGACCACTGCCACAAAGGGGATTCACTTGTTGCCTAGCCATGGATGGTCTAAAAGTTCTTGC
TTCTGGTTTTCTGGTAGATGAGAAGGTCAAGATCAAGGAGTTGGTTACTTCCATGGGGGGCGTTTTACTTTCCAGAGCTT
CTTCTGATGTGAACTTCGTCATTGTGAAAAATGTCTTGGCTGCCAAGTACAAGTGGGCCCTGAATAAGAAGCCAATCGTT
ACTCTGAATTGGTTACATCGGTGTTGGAATGAGCACCGTGTGGTTCCTCAGGAACCATATAAGATTCCTCCTTTTTCTGG
ATTGACAATCTGTGTCACAAGAATTCCAGCAGATGAACGCAAGGGAATGGAAAAGGTAATTTCAGAATATGGAGGGAGCT
ACTCTGCTGAGCTAACAAAGAGTTGTACACATTTGATCGCTGATGCTGCTGAAGGTGACAAATACAAAGTTGCTCGAAAA
TGGGGTCACATTCAAATTGTCACACGGAAATGGTTTCAGCAGTCCATCGATAAAAAGGTTTGTCTCAATGAAGAGTCATA
TCCTGTTCTCGGTTCCATACCCTTGACAAGAGGAGTGCGAGATTTGGGGGTTCATAATGGTCTAGAAAAGTTTCCTTCGG
CTGCAACTGCGTCCGCGGCAGATTCATATGTTTCTTGTGCTCAGTCTAGAGACTCAGATATAGAAGCTTCTGCTTCACAA
AATGTTTTTCCCACTTCTATGAATCCCAGTACCGATGTTAAAGAACCAGGTGGAGGCCCAACGGCAAGGCCGCAAGAGCA
AAACATTGATGGTTGTACTGCCAGGGATTCAGAATCCGAAGACAATGACTTGTACTTATCAGATTGTAGAATTTTCTTGC
TTGGTTTTGAAGCTTCTGAAATGCGTAAACTTGCTAAGTTGGTCCGCAGAGGTGGTGGATCCCGGTATATGCTGCTTAAC
GAAAGAATGACTCATATTGTTGTTGGAACTCCTTCAGAGAGTGAGAAAAGAGAAGCAAGGAGTGTTGCAGCTTCTGGTGT
CATTCAAGTAGTCATACCCAGTTGGCTTGAAGATTGTGATCGTGAGAAAAAAGAAATCCCCGTTCATAATATATATACTG
CTAACCACTTGATTCTTCCAAGAGATTCTGCATGCTTGACCAAGGGGTCATTTGCAAGGATGTCAAGTATGGAACAGACT
AAAAATACTCACGACCAGACCATGGTATATGATTCTTCTTCAAGGAGTATCAATGTCTCAAATGGGCCAGCAACTTTACT
GGGAAAAAACAAAGAAGCAATGCAGGAATTTGGCAGAAAAGATGAGATTCATACAGGAAGAAAAATAGTATCACCCACGC
AAAAAGAAACACTTATTTCCCTTGTAACTTGTGAAAGCAAAGAACAACGGAGTATTCAATGTGAATTCAGTGGTCAGAAC
GATCAAGAAAGAAAGTCATCTGTATTTAAGGGGGAAACATTTTGTTTCTCGCATTCTTTTCCTGAAGATAGGCGACCGCA
AATCGTGGAATGGGTGAATCAAGGAGGGGGAGAGGTGGTAAATGATCCTTTGATAAATAACGCACATTTTACTATTGAAT
GCCATGGTGGGTTCCAAAGTACCGAGACTACCCAAACTATCTATGTCTCAAGTCATTGGGTTCGAAATTGTTTAAAGGTT
GGTTGTTTACTTGCTGTTAGTAGTCATATCCTCTACTCACCTCTTCCCTGCCAGACACCTTTGCCTGGATTCGAAAGCCT
TTGCATATGTAGTTCCCAACATAATGAGAAGAATGTAGAACTCCTGAGAAATTTGAGTGTCGTTCTTGGAGCAGATTTTG
TGGAAAGACTAACCAGGAAAGTGACTCACTTGATATGCAACTTTGCAAAAGGAGATAAGTATGTGAGAGCTTCCAAGTGG
GGAATAATTTCCGTGACACCTGACTGGCTTTATGAATGTGTTAGACAGAATCAAGTTGTTTGTACAGATAACTTCCATCC
AAGGGAATTGACCACTCAAGATCGAGAAGCAGGGTCTCAGTTTCATACACAGTTTGTACCAATGGCCTCAAGGGACAGTA
TGTCTCTACCTGTAAGTCACTCTGAAGACAGGGAAAAAATTCAAAGTTTTGCTGGCAAAAGTGGTTGCGGGAAAGGTGAA
GTATATAACAGACTTGGAGAAATTGGAAAGGAACAAACTTTTCCGTCTAAGAAGGCAAAACTTTTGAGAGATGGTCAAGA
AAGTGATGTGTTTCCTGTGAGAGAACTTCCAAGCAATTGTGATCGTCCTTCGCATTCTGGAGATGGCATTGTGACTGGAT
ATGATGTAGCAAGTGGTCGTGAAGTTCCAGATGTGGCTGATACTATTGAGGATCTGTTAGAGCAGACAAGCAAAATTCAA
GATCAGAAGTCTCCTGGGAGGATTTTAGAAAAGACTCATTTTTCAACTAGTGAACAATACAACACTGGGAATCACTCTGT
CACTGGCCTGTCTAGACACTGGATAAACAGGGTCCATAAGAATGACGACATGGGCAGTCCTCCAGGAGATGCAACTACTG
ACACTTACGGAAACTTTAGTGAGACGCAGACAGAATCACAGGTTGTTGGTTACGAGGAAGATCTTTCAGGAAGGCAGATG
CTTATAGACAGAGTTAGAACACGAAGCAGCTTAACATAA